KEGG   Candidatus Protochlamydia amoebophila: pc0018Help
Entry
pc0018            CDS       T00172                                 

Definition
hypothetical protein
Organism
pcu  Candidatus Protochlamydia amoebophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29961..31583
Genome map
AA seq 540 aa AA seqDB search
MHLKRLLVTLKQQSEKEIKKLQNQLFSQEKISQSLKEQLLQSSAKFKKLQSNHDEELDAL
RDQFISLRNLLQQTQEELRFQNDQAVHASNKMQIIHSNQREEEASGKETERLREELSESN
LRTQEMQALASKNYQKYEQEIQHLKHLLSQREIAEHQTEVIASHTVSYQLRLELEEIKQT
LKQGNYDTKALETHYVEVLNEKVKLEHQIKQLQIELEHQSSNLAAFQIQIPDLNQSKKEL
EECLKEKENLLNHTLEKQEQLKERLFQMELSSQEKMQIQEKYELLKEEWNQLNESLEEAL
DIRVKSEQEVIRFSELLKEKNQILSEKEGQIFQLLRDKENQETHLHEMNHLVNESETRFK
IAQQHLAKKLKEAAILSEKVEGQQRVLEEISQNNENFKIQINQLQASLGISQKQEKKLQE
QLHDALKSTESQVSKWEEKYFCMYDKWQESENCVKKLKKIEEKHQQMQNLIANLGNFMGG
PSSQNFLHTMQELVDKSNQQNNSEEEQPESVQHPSQEDEEKYDLFGMKFRQDKPKPNSLS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttgcatttgaaaagattattagttacgcttaaacaacaaagtgaaaaagagataaaaaaa
cttcaaaaccaattgtttagccaggaaaaaataagtcaatcattaaaagaacaattactt
caatctagtgcaaaatttaaaaaattgcaaagtaatcatgatgaagaattagatgcttta
agagaccaatttatttctcttagaaatcttcttcaacaaactcaagaagaattaagattt
caaaacgatcaggctgttcatgcgtcgaataaaatgcaaattattcattcgaatcaaaga
gaggaggaagctagtggtaaagaaacagagcgcctgcgcgaagaattaagcgagtcgaat
ttaagaactcaagaaatgcaagccctagcttcaaaaaattatcaaaaatatgagcaagaa
attcaacatcttaagcacttattatcgcaacgagaaattgccgaacatcaaacagaagtg
attgcttctcatactgtttcctaccaacttcgcttagaactagaagaaattaaacaaact
ctcaagcaaggtaattatgatacaaaggctttagagacgcattatgtcgaagttttaaat
gaaaaagtcaaacttgaacatcaaattaaacaattgcaaatagaattggagcatcaatct
tctaatttagcggcttttcaaatccaaattccagacttgaatcaaagtaaaaaagagctt
gaggagtgtctaaaggaaaaagaaaatttattaaatcacacacttgaaaaacaggaacaa
ttaaaagaacgtttatttcaaatggaactttcttctcaagaaaaaatgcagattcaagaa
aaatatgagctgttgaaagaagaatggaaccaactgaatgaaagtttagaagaggcgtta
gatattcgtgtaaaatctgaacaagaagtcatacgttttagtgagcttttgaaagaaaaa
aatcaaatattgtcggaaaaagaagggcaaatttttcagttattgcgtgataaagaaaac
caagaaacacatctacatgaaatgaatcatttagtgaatgaaagcgaaactcgctttaaa
attgctcagcaacatttagcaaaaaaattgaaagaagcggctattttatctgaaaaagtt
gaaggtcaacaaagagtgttagaagaaatttctcaaaataacgaaaacttcaaaattcaa
attaatcagcttcaggctagtttaggaatttctcaaaaacaagagaaaaaacttcaagaa
caattacatgatgctttaaaaagcactgaaagccaagtttctaaatgggaagaaaaatac
ttttgcatgtatgacaaatggcaagaaagtgaaaattgcgttaagaaattgaagaaaatt
gaagagaaacaccaacaaatgcaaaaccttatcgccaatttagggaatttcatgggtgga
ccttcctctcagaattttttacacaccatgcaagaattagtagataagtcaaatcaacaa
aataatagtgaagaagaacagcccgagtccgttcaacatccaagccaagaagacgaagaa
aaatatgatttgtttggtatgaaatttaggcaagataaaccaaaaccaaattccctttca
tga

DBGET integrated database retrieval system