KEGG   Candidatus Protochlamydia amoebophila: pc0020Help
Entry
pc0020            CDS       T00172                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    pc0020 (ruvA)
Enzymes [BR:pcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     pc0020 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32105..32710
Genome map
AA seq 201 aa AA seqDB search
MFAYIKGVLAFFNPSQAIVDVHGVGYLLFIPCRLLGQLPQIGEPVQFYTTYVVREFSHTL
YGFLSYQERDIFEILMNVTGIGPKMALSLIGHLSMSELQIAVMRQDLSTLCRVPGVGKKT
AERLIVELKDKLAAIGHLDTSDHIEPLTQDPKSKSVQDAMLALINLGYNQTTAQKAIKQG
MKELPEEIDLAQLITVALKHV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatatataaaaggagtattagcttttttcaatccttctcaagctattgttgat
gttcatggtgtaggatatttactttttatcccttgtcgcctattagggcaacttccccaa
attggggagccagttcaattttataccacttatgtagttagagaattttctcacacgctt
tatggatttttaagttaccaagaacgcgatatttttgaaattttaatgaatgttacaggt
attggtcctaagatggctttaagcttaatcggacatctttcgatgagcgagcttcaaata
gctgttatgcgacaagatttatctacactctgccgtgtcccaggtgttggcaagaaaact
gcggagcgtttaattgtagaattaaaagataagttagctgccattgggcatttagatacg
tctgatcatatagagcctttaacgcaagatcccaaatccaaatctgttcaagatgccatg
ttggcccttataaatcttggttataatcaaaccacagcccaaaaagcgattaaacaaggg
atgaaagaacttccagaagaaattgacttagctcaattaattaccgttgctttgaaacac
gtatga

DBGET integrated database retrieval system