KEGG   Candidatus Protochlamydia amoebophila: pc0020Help
Entry
pc0020            CDS       T00172                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pcu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32105..32710
Genome map
AA seq 201 aa AA seqDB search
MFAYIKGVLAFFNPSQAIVDVHGVGYLLFIPCRLLGQLPQIGEPVQFYTTYVVREFSHTL
YGFLSYQERDIFEILMNVTGIGPKMALSLIGHLSMSELQIAVMRQDLSTLCRVPGVGKKT
AERLIVELKDKLAAIGHLDTSDHIEPLTQDPKSKSVQDAMLALINLGYNQTTAQKAIKQG
MKELPEEIDLAQLITVALKHV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatatataaaaggagtattagcttttttcaatccttctcaagctattgttgat
gttcatggtgtaggatatttactttttatcccttgtcgcctattagggcaacttccccaa
attggggagccagttcaattttataccacttatgtagttagagaattttctcacacgctt
tatggatttttaagttaccaagaacgcgatatttttgaaattttaatgaatgttacaggt
attggtcctaagatggctttaagcttaatcggacatctttcgatgagcgagcttcaaata
gctgttatgcgacaagatttatctacactctgccgtgtcccaggtgttggcaagaaaact
gcggagcgtttaattgtagaattaaaagataagttagctgccattgggcatttagatacg
tctgatcatatagagcctttaacgcaagatcccaaatccaaatctgttcaagatgccatg
ttggcccttataaatcttggttataatcaaaccacagcccaaaaagcgattaaacaaggg
atgaaagaacttccagaagaaattgacttagctcaattaattaccgttgctttgaaacac
gtatga

DBGET integrated database retrieval system