KEGG   Candidatus Protochlamydia amoebophila: pc0161Help
Entry
pc0161            CDS       T00172                                 

Gene name
pgmA
Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00010  Glycolysis / Gluconeogenesis
pcu00260  Glycine, serine and threonine metabolism
pcu00680  Methane metabolism
pcu01100  Metabolic pathways
pcu01110  Biosynthesis of secondary metabolites
pcu01120  Microbial metabolism in diverse environments
pcu01130  Biosynthesis of antibiotics
pcu01200  Carbon metabolism
pcu01230  Biosynthesis of amino acids
Module
pcu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pc0161 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    pc0161 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    pc0161 (pgmA)
Enzymes [BR:pcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     pc0161 (pgmA)
Membrane trafficking [BR:pcu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    pc0161 (pgmA)
Exosome [BR:pcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   pc0161 (pgmA)
  Exosomal proteins of melanoma cells
   pc0161 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Mor
Motif
Other DBs
NCBI-ProteinID: CAF22885
UniProt: Q6MEW4
Position
240480..241160
Genome map
AA seq 226 aa AA seqDB search
MVKLILMRHGQSQWNLANLFTGWVDIPLSFKGIEEAIEAGKQIKNYPIDLIFTSSLIRAQ
MTAMLAMSVHTSGKVPVILHTGEGRLEEWASIYSSESQSQTIPVIRAWELNERMYGELQG
INKEEMAKKYGAEQVHIWRRSFDVPPPNGESLQMTAARTIPYFENTIVPHLKEKKNIFIA
AHGNSLRSIIMKLDGLTTDQVVKLELATGVPVIYDFNHDEYIKQQK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggttaaattaattttgatgcgtcacggccaatctcagtggaatttagcaaatttgttt
actggttgggtagacattcccctgtcttttaaaggaattgaagaggctatagaggcagga
aaacaaatcaaaaattaccctattgatttaatttttacttcttccttaattcgtgctcaa
atgacagcaatgttggcaatgtctgttcatacatctggtaaagtccctgtgattcttcac
acaggtgaggggcgactagaagaatgggcaagtatttatagttccgaatctcaatctcag
acaatacctgtcattcgtgcttgggaattgaatgagcggatgtatggagaattacaagga
ataaataaagaagaaatggctaaaaaatatggagctgagcaggtgcatatttggcgacga
agttttgatgttccccctccaaatggagaaagtttacaaatgacagcagctcggaccata
ccttattttgaaaacaccattgtccctcatttgaaagagaagaaaaatatttttattgct
gcacacggaaattccctgcgttcgattatcatgaaattagatgggctgacaacagatcaa
gtcgttaagttggaactggcaacaggggtgcctgtgatctatgatttcaatcacgatgaa
tatattaaacaacaaaagtag

DBGET integrated database retrieval system