KEGG   Candidatus Protochlamydia amoebophila: pc0161Help
Entry
pc0161            CDS       T00172                                 

Gene name
pgmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    pc0161 (pgmA)
   01230 Biosynthesis of amino acids
    pc0161 (pgmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pc0161 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    pc0161 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    pc0161 (pgmA)
Enzymes [BR:pcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     pc0161 (pgmA)
Exosome [BR:pcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   pc0161 (pgmA)
  Exosomal proteins of melanoma cells
   pc0161 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240480..241160
Genome map
AA seq 226 aa AA seqDB search
MVKLILMRHGQSQWNLANLFTGWVDIPLSFKGIEEAIEAGKQIKNYPIDLIFTSSLIRAQ
MTAMLAMSVHTSGKVPVILHTGEGRLEEWASIYSSESQSQTIPVIRAWELNERMYGELQG
INKEEMAKKYGAEQVHIWRRSFDVPPPNGESLQMTAARTIPYFENTIVPHLKEKKNIFIA
AHGNSLRSIIMKLDGLTTDQVVKLELATGVPVIYDFNHDEYIKQQK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggttaaattaattttgatgcgtcacggccaatctcagtggaatttagcaaatttgttt
actggttgggtagacattcccctgtcttttaaaggaattgaagaggctatagaggcagga
aaacaaatcaaaaattaccctattgatttaatttttacttcttccttaattcgtgctcaa
atgacagcaatgttggcaatgtctgttcatacatctggtaaagtccctgtgattcttcac
acaggtgaggggcgactagaagaatgggcaagtatttatagttccgaatctcaatctcag
acaatacctgtcattcgtgcttgggaattgaatgagcggatgtatggagaattacaagga
ataaataaagaagaaatggctaaaaaatatggagctgagcaggtgcatatttggcgacga
agttttgatgttccccctccaaatggagaaagtttacaaatgacagcagctcggaccata
ccttattttgaaaacaccattgtccctcatttgaaagagaagaaaaatatttttattgct
gcacacggaaattccctgcgttcgattatcatgaaattagatgggctgacaacagatcaa
gtcgttaagttggaactggcaacaggggtgcctgtgatctatgatttcaatcacgatgaa
tatattaaacaacaaaagtag

DBGET integrated database retrieval system