KEGG   Candidatus Protochlamydia amoebophila: pc0662Help
Entry
pc0662            CDS       T00172                                 

Gene name
gmk
Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00230  Purine metabolism
pcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    pc0662 (gmk)
Enzymes [BR:pcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     pc0662 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_22 T2SSE AAA_16 AAA_18 AAA_30 AAA RsgA_GTPase AAA_19 Thymidylate_kin TsaE AAA_33 Ehbp MnmE_helical AAA_25
Motif
Other DBs
NCBI-ProteinID: CAF23386
UniProt: Q6MDG3
Position
806950..807543
Genome map
AA seq 197 aa AA seqDB search
MLLGGKDKKGSLFIVSAPAGTGKTTLVNLLVQEFPTVIASISYTTRAPRLGEVNGKDYYF
ITESEFEAKIAAADFLEYVKLYDTYYGTSREWVEIQRQLGLHVILVIDTQGALQLQKLCE
ATFIFIRPPSLDELKNRLINRQTESLEMIEKRLACAERELEAAQYYDYEIINDDLQEAYQ
VLRSILIAEYHRISKKL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgggtggaaaagacaaaaaaggttctttatttattgtaagcgctccagccgga
acggggaaaacaactctggtaaatttattagttcaagaatttccaacagtgattgcaagt
atttcttacacgacaagagctcctcgtttaggcgaagtcaacggaaaagattattacttt
atcacagaatctgaatttgaagcaaaaatagctgccgctgatttcctcgaatatgttaaa
ctttatgatacttattatggtacgtcacgagagtgggttgaaattcaaaggcagctaggt
ttgcatgttattttagtgattgacacacaaggggcattacaacttcaaaagctgtgcgag
gccacttttatcttcattcgaccaccttctttggatgaattaaaaaatagattgattaac
cgccaaactgaatcgttagagatgatagaaaagcggctggcatgtgcagaacgtgaattg
gaagctgctcagtattatgattatgaaattatcaatgatgatctccaagaagcctatcag
gtattaagaagcattctaattgctgaataccatcgtatatctaagaagctttaa

DBGET integrated database retrieval system