KEGG   Candidatus Protochlamydia amoebophila: pc0689Help
Entry
pc0689            CDS       T00172                                 

Gene name
recD
Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pcu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(837508..839673)
Genome map
AA seq 721 aa AA seqDB search
MEQICGYVERLTFHNSENGYTVAQLQQPKQSELTCIVGCMPGIQPGETIRCNGNWKTHLI
HGRQFEISSFRVEAPADILGIKKYLGSGLIKGIGPKYATRIVDIFGIDTLKIIEESPQRL
LEIEGLGTKRVEKIQACWIEQKSIRDVMIFLQGHGVSPAFAQKIFKKYGSQSILKLKDNP
YCLARDIFGVGFKTADTVAQKMGISKDSEQRIGAGIEYVLSQLSGDGHVCYPVDEFLKEA
ETHLEVKADLIEKRLEGLQSEERIILAQLIHEGKKRDFIWIKPLFIAETGIARELKRLKN
GVSTFRSINKEKAVEWVQAQLKIELAPNQKEAVAKAISTKLHIITGGPGTGKSTITNAIL
QITAILTQKILLAAPTGRAAKRMSEITKRKASTIHSLLEYDFKSTGGFKRNRENPLDCDL
IIIDEASMIDTFLMYSLLKALPDHTRVIFVGDIHQLPSVGPGNVLSDMITSLTISVTTLK
EIFRQAAGSHIITNAHRVNKGMFPSLYNGQNSDFFFIECQENEEVLNTIVKLVSQRLPNR
YGFNPNQDIQVLAPMKKGLIGTEHLNQSLQMILNPKEHALFRGGQKFQVGDKVMQIRNDY
QKEVFNGDIGYILNIDSEEQQVLIQFEDKEVVYDYTDLDELILAYAISVHKFQGSECPCV
VMPVHTSHFMLLHRNLLYTGITRGKKLVVLVGTKKALAIAVKKDDVQKRYTSLQNALMEI
I
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatctgcggttacgttgaaagattgacatttcataattcagaaaatggatat
accgttgcacagctccaacaaccaaaacaaagtgaattaacttgcattgttggatgtatg
ccaggtattcagccaggagaaacgattcgctgtaacggaaactggaaaacgcatctcatt
catggaagacaatttgaaatatctagttttcgagtcgaagcgcccgccgatattttaggg
atcaagaaatatttagggtctggcttgattaaaggaattggaccgaaatacgccactcgc
attgtagatatttttggaatagacactctaaaaattattgaagagtctccccaaaggcta
ttagaaattgaaggactgggaaccaaacgagttgaaaaaattcaagcctgttggatcgaa
caaaaatcgattcgagatgtaatgatttttcttcaagggcatggcgttagtccagcgttt
gctcaaaaaattttcaaaaaatatggttcgcaaagcattttaaaacttaaagataatcct
tattgcttggctcgagatatttttggagtgggctttaaaactgctgatacagttgctcaa
aaaatgggcatttctaaagattcagagcaaagaattggagcaggaattgagtatgtttta
tctcaattatcgggagatggacatgtttgctatccggtcgatgagtttttaaaagaggct
gaaactcatttagaagtaaaggcagatttgattgaaaaaagactcgaagggcttcaaagt
gaagaaaggattatactcgctcaattaattcatgaaggaaaaaaacgggactttatttgg
atcaagccattatttattgccgaaacaggaattgcacgagaacttaaaagactcaaaaat
ggagtcagtacctttcgctcaattaataaagaaaaagctgtggaatgggtacaggcacaa
ttaaaaattgaattagctcctaatcaaaaagaagccgttgccaaagcaatttcgacaaaa
ttacatattattacaggtggcccaggaacagggaaaagcactattacaaatgcaatttta
cagatcactgcgattctaactcaaaaaattttgttagcagctccaacaggaagagcagct
aaacgaatgagcgaaattaccaaacgaaaagcctctacgattcacagccttctggaatat
gatttcaaatcaacaggaggttttaaacgaaatcgagaaaatcctttagattgcgactta
atcatcatcgatgaagccagcatgattgatacgtttttaatgtacagccttttaaaagcg
ctacccgaccacacgcgagtgatttttgttggggatattcaccaattgccgagcgtagga
ccgggtaacgtcttaagtgacatgattacgtctcttaccatctctgtaacgacattaaaa
gaaatttttagacaagcggcaggttctcacattattacaaatgcccatcgagtcaataaa
ggaatgtttcccagcctttataatggacaaaacagtgactttttctttatcgaatgtcag
gaaaatgaagaagttttaaatactatagtcaaattggtctcccaaagacttcctaatcgc
tatggatttaatcctaatcaagatattcaagtattggcccccatgaaaaaagggttaatt
ggcacagaacacctcaatcaatccctacaaatgattcttaatccaaaagaacacgctctt
tttagaggagggcaaaaatttcaagtgggtgataaagtcatgcaaattcgcaatgactat
caaaaagaagtttttaatggagatattggttatattctcaacattgattcagaagaacag
caagttttaattcaatttgaagataaagaagttgtttacgattatactgatttagatgaa
ttgattttagcttacgctatttccgttcataaattccaaggaagcgagtgtccttgcgtt
gtcatgccagttcatacaagtcattttatgttacttcatcgcaatttactttatacaggc
attacacgtggaaaaaaacttgttgttttggttggcactaaaaaagctttagcaattgct
gttaaaaaagatgatgttcaaaaaagatatactagccttcaaaatgctttaatggaaatt
atttaa

DBGET integrated database retrieval system