KEGG   Candidatus Protochlamydia amoebophila: pc0745Help
Entry
pc0745            CDS       T00172                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pcu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(920708..922378)
Genome map
AA seq 556 aa AA seqDB search
MVRCSQSRKCSVYYRNYQYSSCTSIWLSKMIDPTFLLHSLAAKQWERIGIKHHHGINVPL
FSVHSSQSCGIGEFTDLFLLIDWCKSINFDLIQLLPLNDSGLGTSPYSALSAFALSPLYL
GLHALPHLEEFPSLHDELKAIPKLSNHQRVDYKLVRENKERFLHHYYEQAGSLILNSQAY
QAFVQNNAWLKGYAVFKTLKSQYQWSNWESWPIVDQSPTPELLEKVYAKHQSEVDFHCLI
QYLCDQQLKSVKEYADRHGVYLMGDIPILIDRDSADVWLHRSLFDLEFSAGAPPDMYSSE
GQNWGFPIYNWEALAQENYRWWIDRLNWSCRYYHIYRIDHIIGFFRIWSIRRSLTSRQGE
FIPSDEATWVDHGQRIMCVMLRECEMLPIGEDLGAVPDRVRECLSALGICGTRVMRWERL
WKDNGRFLLPQEYPEHSMTTVSTHDSETLQQWWQSFPLEAQVFAQLKGWSYHPYLNREYQ
KEILWDSHHTSSLFHINLLQEYLALIPGLTWPHLEDERINIPGIISERNWSYRFKPSLEE
LTSHPALTYLMQQLII
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
ttggtccgatgctctcaatcaaggaaatgttccgtatattacagaaattaccaatactcc
tcctgcacctccatttggttatcaaagatgatagatcctactttcttacttcattctctt
gcggctaaacagtgggagcgaatcggtatcaagcaccatcatggaatcaatgttccttta
tttagtgttcattcctctcaatcatgcggaattggggaatttacagacctttttctttta
atcgattggtgtaagtcgatcaattttgatttaattcagctcctccctttgaatgatagc
ggtcttggaaccagtccctacagtgccctatcagcctttgctttaagtcccctctattta
gggttacatgctttaccacatttagaagaatttccctctttgcatgatgaattaaaagct
attcctaaattatctaaccatcaacgcgttgactataagcttgtgcgtgaaaataaagaa
cgttttttacaccattattatgaacaagccggttctttgattttaaatagccaagcttac
caagcatttgttcaaaacaatgcctggttaaagggatatgctgtttttaaaactttaaag
tctcaatatcaatggtcgaattgggaaagttggcccattgttgatcaatctcccacgcca
gaattgttagaaaaagtatatgccaagcatcaatccgaagtcgattttcactgcctcatt
caatatctttgtgatcaacagcttaaatctgtgaaggaatatgccgatcgacatggcgtt
tatctcatgggtgatattcctattttgattgatcgagatagcgctgatgtttggttacat
agatctctatttgatttagaattttcggccggagctcctcctgatatgtacagtagtgaa
gggcaaaattggggcttcccaatttacaattgggaagccctcgctcaggaaaattaccgt
tggtggatagatcgtttaaattggtcttgtcgctattatcatatttatcgtatcgaccat
attattggttttttccgcatttggtctattcgtcgcagtttaacgagtcgacaaggagaa
tttattccttctgatgaagcaacttgggtcgatcatggacaacgcattatgtgtgttatg
cttagagaatgtgaaatgcttcctatcggagaagaccttggtgcagtccctgatcgggtc
agagaatgtttaagcgcacttggcatttgtggaacccgtgtaatgcgttgggaacggctt
tggaaagataatggccgttttcttctcccacaagaatatccagaacatagcatgacaact
gtttcaactcatgacagcgaaaccttacaacagtggtggcaatcttttcctttagaagct
caagtcttcgctcaacttaagggctggtcttaccacccttatttaaatcgtgaataccaa
aaagaaattttatgggacagccatcacacaagcagtttatttcatattaatcttttacaa
gaatatttggctcttattcctggtttgacttggcctcacctagaagatgagcggattaat
atcccaggaattatctctgaaagaaattggagctatcgattcaaaccaagtttagaagaa
ctcacctctcatccagcattaacctaccttatgcaacaacttattatttaa

DBGET integrated database retrieval system