KEGG   Candidatus Protochlamydia amoebophila: pc0801Help
Entry
pc0801            CDS       T00172                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pcu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pcu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pcu00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
980629..981423
Genome map
AA seq 264 aa AA seqDB search
MSPSHRPVVITGNWKMYKTVKEACTFAKALLPVVEVSPIQVWIAVPFTAIYPVKQEIRNS
RLVIGAQNMNDASEGAFTGEIAGKMVKEAGASFVLLGHSERRHLYKEDNAFINRKVKKAL
EIGLTPVLCVGETFEERKSGETQQIIRTQIQECLAGLTAEDLKTLIIAYEPVWAIGNGQN
AKPEGAQEIHQFCRKIIKEIFSEELAEQIVIQYGGSVNPSNAISLLKQPDIDGLLIGGAS
LSLETFVEIVNDGGSIFNLKAKLL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtccatcgcatcgccctgttgtcattacaggcaattggaaaatgtataaaaccgtt
aaagaggcttgcacttttgcaaaagccttacttccagtggttgaagtaagccctattcaa
gtatggattgctgttccttttacagccatttatcctgttaaacaagagattcgaaattcg
cgattagtaattggtgcgcaaaatatgaacgatgcctctgaaggggcttttacaggcgaa
atcgcaggtaaaatggttaaagaagcaggtgcttcctttgttttattagggcactctgaa
cgtcgccatctttataaagaagataatgcttttattaatcgaaaagtgaagaaagcttta
gaaattggcctcactcctgtgctttgtgttggtgaaacattcgaagaacgaaaatccggt
gaaacacaacaaatcattcgtactcaaatacaagaatgtttagctggattaacagctgaa
gacttaaagaccttaataattgcttacgaacctgtttgggctattgggaatggtcaaaac
gcaaaacctgaaggggcacaagaaattcatcagttttgtcgaaaaatcattaaagaaatt
ttttctgaagagttagccgaacagattgtcattcaatatggcggatcggtgaatccttct
aacgcaatctcattacttaaacaacccgatatcgatggtcttttaatcggaggcgcatca
ctttctcttgaaacttttgttgaaattgtgaatgatggtgggtcaatattcaatctgaag
gcaaaattactatga

DBGET integrated database retrieval system