KEGG   Candidatus Protochlamydia amoebophila: pc0801Help
Entry
pc0801            CDS       T00172                                 

Gene name
tpiA
Definition
(GenBank) probable triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00010  Glycolysis / Gluconeogenesis
pcu00051  Fructose and mannose metabolism
pcu00562  Inositol phosphate metabolism
pcu01100  Metabolic pathways
pcu01110  Biosynthesis of secondary metabolites
pcu01120  Microbial metabolism in diverse environments
pcu01130  Biosynthesis of antibiotics
pcu01200  Carbon metabolism
pcu01230  Biosynthesis of amino acids
Module
pcu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pc0801 (tpiA)
   00051 Fructose and mannose metabolism
    pc0801 (tpiA)
   00562 Inositol phosphate metabolism
    pc0801 (tpiA)
Enzymes [BR:pcu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     pc0801 (tpiA)
Exosome [BR:pcu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   pc0801 (tpiA)
  Exosomal proteins of bladder cancer cells
   pc0801 (tpiA)
  Exosomal proteins of melanoma cells
   pc0801 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Tex_YqgF Resolvase
Motif
Other DBs
NCBI-ProteinID: CAF23525
UniProt: Q6MD24
Position
980629..981423
Genome map
AA seq 264 aa AA seqDB search
MSPSHRPVVITGNWKMYKTVKEACTFAKALLPVVEVSPIQVWIAVPFTAIYPVKQEIRNS
RLVIGAQNMNDASEGAFTGEIAGKMVKEAGASFVLLGHSERRHLYKEDNAFINRKVKKAL
EIGLTPVLCVGETFEERKSGETQQIIRTQIQECLAGLTAEDLKTLIIAYEPVWAIGNGQN
AKPEGAQEIHQFCRKIIKEIFSEELAEQIVIQYGGSVNPSNAISLLKQPDIDGLLIGGAS
LSLETFVEIVNDGGSIFNLKAKLL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtccatcgcatcgccctgttgtcattacaggcaattggaaaatgtataaaaccgtt
aaagaggcttgcacttttgcaaaagccttacttccagtggttgaagtaagccctattcaa
gtatggattgctgttccttttacagccatttatcctgttaaacaagagattcgaaattcg
cgattagtaattggtgcgcaaaatatgaacgatgcctctgaaggggcttttacaggcgaa
atcgcaggtaaaatggttaaagaagcaggtgcttcctttgttttattagggcactctgaa
cgtcgccatctttataaagaagataatgcttttattaatcgaaaagtgaagaaagcttta
gaaattggcctcactcctgtgctttgtgttggtgaaacattcgaagaacgaaaatccggt
gaaacacaacaaatcattcgtactcaaatacaagaatgtttagctggattaacagctgaa
gacttaaagaccttaataattgcttacgaacctgtttgggctattgggaatggtcaaaac
gcaaaacctgaaggggcacaagaaattcatcagttttgtcgaaaaatcattaaagaaatt
ttttctgaagagttagccgaacagattgtcattcaatatggcggatcggtgaatccttct
aacgcaatctcattacttaaacaacccgatatcgatggtcttttaatcggaggcgcatca
ctttctcttgaaacttttgttgaaattgtgaatgatggtgggtcaatattcaatctgaag
gcaaaattactatga

DBGET integrated database retrieval system