KEGG   Candidatus Protochlamydia amoebophila: pc0873Help
Entry
pc0873            CDS       T00172                                 

Gene name
potC
Definition
spermidine/putrescine ABC transporter permease
Orthology
K11070  
spermidine/putrescine transport system permease protein
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
ABC transporters
Module
Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pc0873 (potC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055627..1056394
Genome map
AA seq 255 aa AA seqDB search
MKKSPLSFWITVFVLIFLYVPILVLIINSFNDSRFGGQWVGFTYKWYDRLWNEHKMWYAL
RNSLIVGVSATIVSTFLGTCAAFALHLYKSKLQNFHYGLIYTPLLIPDILTGISLLLFFV
TVNVKLGLFTVFIAHTTFCMSYVTMVMLSKLQNFDFTLIEAAQDLGANTWTLIKKILLPL
LAPGLMTGALLAFILSIDDFVITFFVAGQGVLTLPVYVYNMIKFGSTPIVNALSVLILGV
TFVFIFFTQRLSKED
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtccattaagtttttggatcacagtttttgttctcatttttttatacgtt
cccattctcgtcttaatcattaattcttttaatgattcacgatttggtggacaatgggtt
ggttttacttataaatggtatgatcggctttggaatgagcataaaatgtggtatgctttg
cgtaattctttaatcgtaggtgtgtctgcgacaattgtgtcgacttttttaggaacgtgt
gcagcttttgctttacacctttataaatccaaattacaaaattttcattacggactcatt
tataccccgctacttattcctgatattctaacaggaattagtcttcttctattttttgtc
actgtaaatgtaaaattgggcctttttacggtctttattgcacacaccacattttgcatg
agttatgttacaatggttatgctttcaaaactgcagaattttgattttactttgatagaa
gccgcacaagatttaggagcaaatacctggaccttaatcaaaaagattttacttccttta
ttagcaccaggattaatgactggagctcttttagcttttattctttctattgacgatttt
gtcattactttttttgttgcggggcaaggggttttgacgttgcctgtttatgtttacaat
atgattaagtttggatcgacacctatagtgaatgcgctttctgttctgattttgggcgtg
acatttgtatttatattttttacacaacgtttatctaaagaggattga

DBGET integrated database retrieval system