KEGG   Candidatus Protochlamydia amoebophila: pc0935Help
Entry
pc0935            CDS       T00172                                 

Gene name
glk
Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00010  Glycolysis / Gluconeogenesis
pcu00052  Galactose metabolism
pcu00500  Starch and sucrose metabolism
pcu00520  Amino sugar and nucleotide sugar metabolism
pcu00521  Streptomycin biosynthesis
pcu01100  Metabolic pathways
pcu01110  Biosynthesis of secondary metabolites
pcu01120  Microbial metabolism in diverse environments
pcu01130  Biosynthesis of antibiotics
pcu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pc0935 (glk)
   00052 Galactose metabolism
    pc0935 (glk)
   00500 Starch and sucrose metabolism
    pc0935 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    pc0935 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    pc0935 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    pc0935 (glk)
Enzymes [BR:pcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     pc0935 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: CAF23659
UniProt: Q6MCP0
Position
complement(1126238..1127221)
Genome map
AA seq 327 aa AA seqDB search
MLKETDCVIGIDLGGTKIGIGVLNVSGTLIDSVRLKTDFKHGPASVEKQIMQAIQDLKNR
TKVEIKGIGIGVAGQIDEETGVVRFAPNLPGWHQVTLRKNLEREAEIPVKVVNDVRAITW
GEWLYGAGKHYQDLICLFVGTGIGSGIVCQGKMQKGDNNTFGEVGHMTIDFHGPRCTCGN
NGCFEAFAGGWGIARQAKELILADNQSGQSILEKAGGYLENVSAKAVIEAYHSGDPLALL
ILEKVKQALIAGCINLVNAFNPACLILGGGVLDGIPEILSFIDKGIRETALKTATDKLQI
KTALLGKNVGIIGSGAVILDVLKNNVG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagaaacagattgtgtcattggaatcgatttagggggaaccaaaattgggata
ggagttttgaatgtctccggcacattgattgatagtgtgagacttaaaacggattttaaa
cacggaccagctagtgtcgaaaaacaaatcatgcaagcgattcaggatttaaaaaatcgg
acaaaagttgagattaaaggaattggaataggggtagcaggtcaaattgacgaagaaaca
ggagtcgttcgttttgctccaaatctcccaggctggcatcaagtaacactacgcaaaaat
ctggaaagagaagctgaaattccagttaaggttgtgaatgatgttcgcgctattacttgg
ggagaatggctttacggagctggtaaacattatcaagatcttatttgtttattcgtagga
acaggaattggcagtggtatcgtttgccagggaaaaatgcaaaaaggggataataataca
tttggagaagtcggccatatgacaatcgattttcatggccctcgttgcacctgcggtaac
aatggttgttttgaagcttttgctggaggatggggaattgctagacaggccaaagaactc
attcttgccgataaccaaagtggtcaatccattttagaaaaagcaggtggatatttagaa
aatgtttcagctaaagctgttattgaagcataccacagtggagaccctctagctctatta
attttagaaaaagtcaagcaagccttaattgcaggttgcattaatcttgtgaatgctttt
aatcctgcttgtttaatcttaggaggtggggttctagatggtattccagaaatcctatca
tttattgataaaggcattcgagaaactgctttaaaaacggcgacagacaaattacagata
aaaactgctttacttggtaaaaatgtgggaattattggatctggagctgtaattttagac
gtcttaaaaaataacgttgggtga

DBGET integrated database retrieval system