KEGG   Candidatus Protochlamydia amoebophila: pc1220Help
Entry
pc1220            CDS       T00172                                 

Gene name
dhcR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    pc1220 (dhcR7)
Enzymes [BR:pcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     pc1220 (dhcR7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451379..1452686
Genome map
AA seq 435 aa AA seqDB search
MLPTQTSFFRQTFGPLILLLLCPPTVFAFWYTNTYLEGSLFRFTEFAWQQGFLSTLKTIW
FPYFFGTSIAWTMLVILASLQLILMRILPGERYEGPITPAGHVPLYKANGFSAFIVTISI
FLIASYYYQLFAPTIIYDNFPGLLGALNIFSLCFCFFLVLKGHYFPSNGDVGGSGNIIFD
YYWGMELYPRLLGWDIKQFTNCRFGMMSWALIVISFAAKQQQLDGLSDSMFVAVALQLIY
ITKFFIWEPGYLRSLDIMHDRAGYYICWGCLVWVPGIYTSPTLYLVDHPNHLGLALSSLL
FVVGVIGILVNYLADRQRQLVRKNQGNCRIWGKEPILTVAKYTTQTGESKQNLLLASGWW
GLSRHFHYLPELLGAFCWSAPALFENFLPYFYFVFLTILLTDRAFRDDQRCSKKYGEDWK
IYCQRVPYKIIPFVI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgttgccaacacaaacatctttttttcgacaaacttttggtcctttgattcttttatta
ctttgccctcccactgtgtttgctttttggtacaccaatacttatttagaaggctctctt
tttcgttttacagaatttgcttggcaacaaggttttctttccacattaaaaacgatttgg
tttccttatttttttggaacttctatagcctggacaatgttagtaattcttgcttctctt
cagcttattttaatgcgcattctgcctggagagcgctatgagggaccaatcactcctgct
ggacacgttcccctttataaggcaaatgggttttctgcttttattgttacgatctccatt
tttttaatcgcatcctattattaccaactgtttgctccaacaattatttatgacaatttt
ccgggtctacttggagccttgaatatatttagtttatgcttttgcttttttcttgtccta
aaagggcattattttccctcaaatggcgatgttggaggatcgggaaatatcatttttgat
tattattggggaatggaactttaccctcgcttactcggttgggatattaagcaatttact
aactgtcgatttggaatgatgagctgggctttaattgtgatttcttttgctgctaaacaa
caacagcttgatggattaagcgattccatgtttgttgcagtagctctccaactgatttat
attacaaaattttttatctgggaaccaggctaccttcgttcgttagatatcatgcacgac
agagctggttactatatttgttggggatgccttgtttgggttccaggtatttatacatcc
cccactctctatttagttgatcaccccaatcacttaggtttagctctatccagtttatta
tttgtcgttggggtgattggaattttagttaactatttggcagatcgccaaagacaatta
gtgagaaaaaatcaaggaaattgccgtatttgggggaaagaacccattttgacagttgca
aaatatacaacacaaacaggagaatcgaaacaaaatcttttacttgcctctggctggtgg
ggtttgtctagacattttcattatcttcctgaactgcttggagccttttgttggagtgca
ccagctctatttgagaattttctaccctatttttattttgttttcttaaccattttatta
actgatcgcgcctttagagatgatcaacgctgctcaaaaaaatatggggaagattggaaa
atttattgtcaaagagtcccttataaaattattccctttgttatttaa

DBGET integrated database retrieval system