KEGG   Candidatus Protochlamydia amoebophila: pc1255Help
Entry
pc1255            CDS       T00172                                 

Definition
eucaryotic stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    pc1255
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    pc1255
Enzymes [BR:pcu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     pc1255
Lipid biosynthesis proteins [BR:pcu01004]
 Desaturase
  First
   pc1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1496370..1497515
Genome map
AA seq 381 aa AA seqDB search
MKIKEFNWGPTLFLTIYQTLLLLSLPFYFYFTPPSLGMIGISIILLYLTGLSITAGYHRF
YSHRSYRTNSFVEMLLLFFGSMAGQGSALRWSFDHRLHHAHVDTDCDPYSIKKGFWYAHC
LWILEKPKKIEAKVVPDLIKNRLVQFQHKYDFLCMLISNGIAFLVVGWFLDDYMGAFFLA
CWTRLFLLHHFTWFINSLAHTWGDRPFCQEQSAVNNYILALLTFGEGYHNYHHTFCNDYR
NGIRWFHFDPTKWLIWTLSKCGLTKELKRMDSYTIQKRMVLERKRLLLGRVCNLWYVKKD
ELEKLVRELAEKLVVEFAEFNQLRVNYRLARKEGREPDQLKVFKQKLSILKKNLKSNWRL
WKQLSRHILKLKPFESFPCPI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaagaatttaattggggaccgacactcttcttaacgatttatcagactctt
cttctcctttctttacccttttacttctactttactcccccttctttaggaatgattgga
atatcaatcattttactttatttaaccggtttaagtattacagcaggttatcaccgattt
tattcacatcgaagctatcgaacaaattcttttgtggaaatgcttctcttattttttggt
tcaatggctggtcagggaagtgctctaagatggtcatttgatcatcgcttgcatcatgcc
cacgtcgatacagattgtgacccttattctataaaaaaggggttttggtatgctcattgc
ctatggattttagaaaagcctaaaaaaattgaagctaaagttgtgcccgatttaataaaa
aatcgtcttgttcaatttcaacataaatatgatttcctttgtatgctcataagtaatgga
attgcttttttagttgtcggttggtttttagatgattatatgggagctttttttctagct
tgctggacacgtttatttcttcttcatcactttacgtggtttatcaattcacttgctcac
acctggggtgatcgcccattttgccaagagcaatcagcggtcaacaattatattttggcc
ctattaacttttggtgaaggttatcataactatcaccatactttctgtaatgattaccga
aatggaattcgctggtttcattttgaccccacaaaatggctcatttggacacttagcaaa
tgtggtttgactaaagagctgaaacggatggattcttataccatccaaaaaagaatggtt
cttgaaagaaaaaggttattactaggtcgcgtttgcaacttatggtatgtaaaaaaagat
gaacttgaaaaacttgttcgcgaactagctgaaaaattagttgtagaatttgctgaattt
aaccaattgcgagttaactaccggcttgctcgaaaagaagggcgagaaccagatcaatta
aaggtttttaaacaaaaattgtctatcctcaaaaaaaatcttaaaagcaattggcggtta
tggaaacaactctctcgtcatattttaaaactcaaaccttttgagtcctttccctgccct
atttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system