KEGG   Candidatus Protochlamydia amoebophila: pc1512Help
Entry
pc1512            CDS       T00172                                 

Gene name
hemG
Definition
(GenBank) putative protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00860  Porphyrin and chlorophyll metabolism
pcu01100  Metabolic pathways
pcu01110  Biosynthesis of secondary metabolites
Module
pcu_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    pc1512 (hemG)
Enzymes [BR:pcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     pc1512 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     pc1512 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 NAD_binding_9 Pyr_redox MCRA Trp_halogenase Thi4
Motif
Other DBs
NCBI-ProteinID: CAF24236
UniProt: Q6MB13
Position
complement(1807876..1809249)
Genome map
AA seq 457 aa AA seqDB search
MVKHIVILGAGISGLATAWFLKKLLGSSVQLTLLEANSRAGGWIQTIHSQDFLFETGPRS
CRSKGSGREMLQLIEELGLCDEIIGAHSSANLRFLYFQKKLQPLPSSFFHILFNPLVKGW
LKAVYRDLNSPRSLKEDESIEEFFSRRIGKEWTSRLIDPFVSGIYAGDCKKLSMKSCFPL
FWKWEQENGSLIKGIWNQKKEKKSSSAFVSYWMKQPLFSFKQGMGYLIQSFVHQLDANIH
FSSTVKTIEMEKEGATVVLDNGKVFKADHLISTLPASKLAPLLGSEFSETASLLQSMEST
SVMVVNCGYRRPVLKKSGFGYLIPFQEKESILGCVWDSAVFPKQNFSPEHTRLTVMMGGT
QHPQIDDRQKGLALALSSIERHLAIDSVPDEVYVSLAKQAIPQYQIGHYLTLINLSQSLS
LYPQFTFTGHSFDGVSVNDRVLQARLLAVKIAKGFNI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaacatatcgtgatcttaggtgctggaattagcggacttgcaacagcatggttt
ttgaaaaaactattaggatcttccgttcaacttactttgttagaagcaaattcaagagcc
ggaggatggattcaaacgattcattctcaagattttttgtttgagacaggtccacgcagt
tgccgttcgaaaggctctggaagagaaatgcttcaactcattgaagaattaggattatgt
gatgaaatcattggggcacattcttctgcgaaccttcgttttctttattttcaaaaaaaa
ttacagcctttacccagttccttttttcatattctttttaaccctcttgttaaaggatgg
ctcaaagcggtttatcgggatttaaattctccaaggtcgttaaaagaagatgaatctata
gaagaattttttagccgacgtattggaaaagaatggacctcccgtttaattgatccattt
gtttcaggaatttatgctggagattgcaaaaaattatccatgaaaagctgttttcctctt
ttttggaagtgggaacaagaaaacggatctttaattaaagggatatggaatcaaaaaaaa
gaaaaaaaatcctctagcgcttttgtttcatattggatgaaacaacctcttttttccttt
aagcaaggaatgggatatttaatacaatctttcgtgcatcaattagatgctaatattcat
ttttcttctactgtgaaaacgattgaaatggaaaaagagggggccacagttgttttagat
aacggaaaagtttttaaagctgatcatttgatttctactttgccagcttcaaaattggct
cctttacttggttcagagtttagtgaaacggcttcactgctacagtctatggaatcaacc
tctgtgatggttgtcaattgtggttatcgtcgacctgttttaaaaaaatctggctttggt
tatttaattccctttcaagaaaaagaatcaattttgggatgtgtatgggattcagcagtg
tttcctaagcaaaatttttctcctgaacacactcgcttaacagttatgatggggggaact
cagcaccctcagatagatgataggcaaaaaggattagcccttgcattatcttctatcgaa
aggcatttggcgattgattctgtgccagatgaagtttatgtttctttagccaaacaggcg
atccctcaatatcaaattggacattacctaactttaatcaatttatctcaatccttatct
ctttatccccaattcacttttacaggtcattcttttgacggggtttctgtgaatgataga
gttttgcaagcccgtttattagccgttaaaattgcaaaaggttttaacatttag

DBGET integrated database retrieval system