KEGG   Candidatus Protochlamydia amoebophila: pc1724Help
Entry
pc1724            CDS       T00172                                 

Gene name
recR
Definition
(GenBank) probable recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    pc1724 (recR)
DNA repair and recombination proteins [BR:pcu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     pc1724 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      pc1724 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2061749..2062345
Genome map
AA seq 198 aa AA seqDB search
MRYPEHLLKLIHILKKFPGVGHKSAERFAFHLLNWPMEHLIELSETVKNTKDKIKQCLNC
GCLTDEAACYFCDINQRDSQIICVTAFPRDVFSIEETHEYRGLYHVLGGVLSPLENRGPE
HLSISRLKHRIQDLQIKEVVIALDSTLEGDATALFLKQELAADDIQISRLAFGLPMGSSL
DYVDGGTLARALAGRSRF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgttaccctgagcatttattaaagttaattcatattttgaaaaaatttccgggtgtg
ggccataaaagtgccgagcgttttgccttccatctattaaattggccgatggagcatctc
attgaattaagcgaaactgtcaaaaatacaaaagacaaaataaaacaatgtttgaactgc
ggctgtttaacagatgaggcagcttgttatttttgtgatattaatcagcgagactcgcaa
attatttgcgtgacagctttcccgcgtgatgtgttttcaattgaagaaactcacgaatat
cggggtttatatcacgttttaggaggggtattatctcctttagaaaatcgtggaccagaa
catttatcaatttctcgactaaaacatagaatccaagacttacaaattaaagaggttgtt
attgctttagattctacgttagaaggagatgcgactgccctattcctcaaacaagaattg
gctgccgacgacattcagatttctcgtctcgcgtttggccttcctatggggagctcacta
gattatgtagatggaggcactttagccagagcattagcagggcgcagtcgcttctaa

DBGET integrated database retrieval system