KEGG   Candidatus Protochlamydia amoebophila: pc1731Help
Entry
pc1731            CDS       T00172                                 

Gene name
pdhC
Definition
(GenBank) probable pyruvate dehydrogenase, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00010  Glycolysis / Gluconeogenesis
pcu00020  Citrate cycle (TCA cycle)
pcu00620  Pyruvate metabolism
pcu01100  Metabolic pathways
pcu01110  Biosynthesis of secondary metabolites
pcu01120  Microbial metabolism in diverse environments
pcu01130  Biosynthesis of antibiotics
pcu01200  Carbon metabolism
Module
pcu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pc1731 (pdhC)
   00020 Citrate cycle (TCA cycle)
    pc1731 (pdhC)
   00620 Pyruvate metabolism
    pc1731 (pdhC)
Enzymes [BR:pcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     pc1731 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: CAF24455
UniProt: Q6MAE4
Position
complement(2070586..2071887)
Genome map
AA seq 433 aa AA seqDB search
MPFTLTMPKLSPTMEEGTLIKWHKKIGDSIQTGDLLIEVATDKATVEYNAIDDGWLRQIL
IQEGKDAAVNQAIAILTVDQNESLEGYQADGVKEKALQLSSDSIEMPELNYKEKKEPKSK
TTAFQQPVFVPEFPLENYTFEFPIERGDKKLLASPLAKKLAKEKGLDLTTVKGTGPQQRI
ISRDLDKAQAAGVVNFGHRETPQLPPGSYEELSLTPMRKVIGQRLQESKSFIPHFYVTLT
IDASPLTQIREQLKNNQVKVSINDFIVRACALALRQNPGLNCGFNSANQSIIQFKTIDIA
VAVSLEEGLITPIIRHADFKNLGELSVEMRVLAQKAREGKLEPQEYKGGSFTISNLGMFG
VSEFQAILNPPQAAILAVSGILDVPVIQNNMVIPGKTMNLTLSVDHRVIDGVAAAKFLQS
LKQLLENPAGLLL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccttttacactgacaatgcccaaactctctcccacaatggaagaaggaacactgatc
aagtggcataaaaaaattggggattcgatacaaactggcgacttgctaattgaagtagct
actgataaagcaactgtagaatataatgctattgatgacggatggcttaggcagatttta
attcaggaaggaaaagatgctgctgttaatcaagctatagcgattttaaccgtcgatcag
aatgaaagtttagaaggttaccaagcagacggggtaaaagaaaaggctttgcaactttca
tctgacagcattgagatgccagagttaaattacaaagagaagaaagaacctaaaagtaaa
actacggcttttcaacagcctgtctttgtcccagaatttcctttggaaaattatacgttt
gaattcccgatagaaagaggggataaaaaattattagcttcccccttagctaaaaaactc
gctaaagaaaaaggattagatcttacaacagtaaaaggaacaggtcctcaacaacgaatt
ataagtcgagatcttgacaaagctcaagctgctggagttgtcaattttggacatcgtgag
actcctcaattacctccaggtagttatgaagaattatctttgactcctatgcgtaaagtt
atcggacaaaggttacaagaatctaaatcctttattcctcatttttatgtcactttaaca
atcgatgctagtccattgacccaaatcagagagcaacttaaaaataatcaagttaaagta
tctatcaatgatttcattgttcgagcctgtgcattagctttacgtcagaatcccggttta
aattgtggtttcaattctgcgaatcaatcgattattcaatttaaaacaattgatattgca
gttgctgttagcctggaagaagggctaatcactcctattattcgtcacgcagactttaaa
aatttaggagaactgtcggtagaaatgcgtgtgttggctcagaaagcacgtgaaggaaag
cttgaacctcaagaatataaaggaggatcatttacgatttcaaatttaggaatgtttggt
gtttccgagtttcaagcgatactaaatcctccacaagcggctattctcgctgtgagtgga
attttagatgttcctgttattcaaaataacatggtgatacccggtaaaacaatgaattta
actttatcagttgatcaccgtgtaatagatggggtggcggctgccaaatttcttcaaagt
ttaaagcaattgttagaaaatcccgctggattattgctttaa

DBGET integrated database retrieval system