KEGG   Candidatus Protochlamydia amoebophila: pc1761Help
Entry
pc1761            CDS       T00172                                 

Gene name
glgB
Definition
(GenBank) probable 1,4-alpha-glucan branching enzyme (= Glycogen branching enzyme)
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00500  Starch and sucrose metabolism
pcu01100  Metabolic pathways
pcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    pc1761 (glgB)
Enzymes [BR:pcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     pc1761 (glgB)
Exosome [BR:pcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   pc1761 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: CAF24485
UniProt: Q6MAB4
Position
complement(2105546..2107729)
Genome map
AA seq 727 aa AA seqDB search
MMTMQQTEFDSQFNEHIYRIVHVVHHQPHAFLGLHSFFEGSKVIRLWRPNAQQIFLELFG
NIVEARRIHEMGIFECIVPSHTTAIDYKIFHQNGKLHFDPYAFLPTFGEVDQYLFGKGVH
YELYHQMGGRLATHQGIQGVKFAVWAPNAKSVSLIADFNHWDGKVNPMRIMGYSGVWELF
VPGLQEGEKYKFEIHTQQGERILKSDPYALSSELRPATASKIANIERFQWQDQAWMEQRK
AKNWTSLPMNIYEVHLGSWKKKDSNSEFLNYRELAHELTAYCLDMGFTHIELLPIQEHPL
DESWGYQVSGFYAPTSRFGHPEDFQYFVNYLHQHQISLILDWVPGHFPTDAFSLARFDGS
ALYEHADPRQGYHPHWHTNIFNFGRHEVSNFLIANALYWLEIMHVDGLRVDAVASMLYLD
YGREENEWIPNDVGGKENLQAIEFLKHLNSIVHSKCPGSLMIAEESTSFTGVTHSVEKGG
LGFDLKWNMGWMNDTLRYFSKDMLFRNYHHHDLTFGLVYAFSEKFISVFSHDEVVHGKKS
LLSKMPGDMWQQFANLRLLISYMICQPGKKLLFMGAEIGQWNEWNCKSGLEWFLLQFPTH
AGIHKFVQEINHFYLKQPALWQKDFSHESFEWVDFADMHNSVISYVRKGGTERLLCVHNF
TPLYHSDYILHLSQFEHIEEIFNSDAEKFGGSGKHNLNPEIIRNEARSVIGLRLILAPLA
TLIFKLS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatgcaacagactgaatttgactctcaatttaatgaacacatttatcgtatc
gttcatgttgttcatcaccaacctcatgcttttttgggtcttcattcttttttcgaagga
tctaaagttattcgactttggagacccaatgcgcaacaaatctttctagaattattcgga
aatattgttgaagctaggcgtattcatgaaatggggatttttgaatgtattgttcctagt
catacaacagctatagattataaaatatttcatcaaaatggaaagcttcattttgatcct
tatgcatttctacccacatttggagaagtcgatcaatatctgtttggaaagggtgttcat
tatgaactttatcaccaaatgggcggaaggttagcaacgcatcagggtattcaaggagta
aaatttgctgtttgggctcctaatgcgaaaagtgtttccttaatagctgattttaatcat
tgggatggaaaggtcaatcctatgcgtatcatgggatactcgggtgtttgggaattattt
gtacctggtttgcaagagggagaaaaatataagttcgaaattcatactcaacaaggggaa
agaattcttaaatccgatccttatgcgttgtcaagtgaactgcgtccagcaacggcctct
aaaattgctaatattgagcgttttcaatggcaagaccaagcgtggatggaacaaagaaag
gcgaaaaattggacttctttacctatgaatatctatgaagttcatttggggtcatggaaa
aaaaaggattcgaattcagaatttttaaattatcgagaacttgcccatgaattgactgcc
tattgtttagatatgggatttactcatatagaacttcttcctattcaagaacatccttta
gatgagtcttggggatatcaagtttctggtttttatgccccaactagtcgctttgggcac
cctgaagattttcaatattttgtgaattatcttcatcaacaccagataagtcttatttta
gattgggttcccggacattttccaacagatgcattttcattagcacgttttgacggctca
gctctttatgaacatgcagatcctcgtcaaggctatcatcctcattggcatacaaatata
ttcaattttggtcgacatgaagtctccaattttttaattgctaatgccttgtattggtta
gaaatcatgcatgtcgatggccttcgagtcgatgctgttgcttccatgctatatttagat
tatggcagagaggaaaatgagtggattcccaacgatgttggagggaaagaaaatttacaa
gcgatcgaatttttaaaacatttgaattctattgtgcattctaaatgtccaggttcattg
atgattgcggaagaatctacatcatttacaggggttacgcattccgtagaaaaaggggga
ttggggtttgacttgaaatggaatatgggatggatgaatgatacactgcgttatttttcc
aaagatatgttatttagaaactaccatcatcacgatctaacttttggattagtttatgca
ttctctgaaaaatttatttctgttttttcacacgatgaagtcgttcatggtaaaaaaagc
ttattgagcaaaatgcctggggatatgtggcaacaatttgctaacttacgtttattgatt
agctatatgatttgtcaaccgggtaaaaaactgctgttcatgggtgcagaaattggacaa
tggaatgaatggaattgtaaatcgggactggaatggtttttattgcaatttcctacccat
gctggaattcacaaatttgttcaggaaattaatcatttttatttaaaacagccagctcta
tggcaaaaagactttagtcatgaatcttttgaatgggtagattttgcagatatgcacaat
agcgtgattagttatgtccgtaaagggggtacagaacgccttctttgtgtccataatttt
acgcctctttatcactctgattatattttacacttaagtcagtttgagcacatcgaagaa
atttttaattcagatgcagagaaatttggaggctctggaaaacataatttgaacccagaa
attattcgaaatgaagctaggtctgtaatagggttacgtctcatcttagcccctcttgct
accctaatttttaaactctcttag

DBGET integrated database retrieval system