KEGG   Candidatus Protochlamydia amoebophila: pc1869Help
Entry
pc1869            CDS       T00172                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    pc1869
   01230 Biosynthesis of amino acids
    pc1869
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pc1869
  Energy metabolism
   00680 Methane metabolism
    pc1869
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    pc1869
Enzymes [BR:pcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     pc1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2228252..2228899
Genome map
AA seq 215 aa AA seqDB search
MVDKNLFCDIYLIRHGETDWNMLGKLQGHIDISLNSSGKIQARNLQKQLNHINFAAAFSS
DLSRARQTAEIVLESKDIKIEETAVLRERQLGEWEGQSIDDLKNWLQKNSQIDSFTQEDF
LAYKWDSISENYAEVFNRLSRLVLKISPLYLGSTILLSSHGGLLRSVLYQLDFKSELRWH
VDNCGFIKIRANNRGGMTIAECHGIKTSRASSSTF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaaaatttattttgcgatatttatttaatccggcatggagagacagattgg
aacatgttaggaaaattacaagggcatattgatatttctcttaacagctcaggtaagatt
caagctcggaaccttcaaaagcaactgaatcacattaattttgcagcagctttttcctct
gatcttagccgagcgcgtcaaacggcagaaattgttctcgaatcaaaagacattaagata
gaggaaacagctgttttaagagagcgacagctaggcgaatgggaaggtcaatcaatagat
gacctaaaaaattggttgcaaaagaacagtcaaattgattctttcactcaagaagatttt
ttagcctacaagtgggattcaatatctgaaaactatgcagaagtattcaaccgtttgtct
aggcttgttttaaagatctctccattgtacttaggctctacaattttgctgtcttcccac
ggaggattattacgctcagttctttatcagttggattttaaaagtgaactcagatggcat
gtagataattgtggatttattaaaatacgtgccaataatagaggtggaatgactattgcg
gaatgtcatgggattaagacctcaagagcctcctcttcaacattttga

DBGET integrated database retrieval system