KEGG   Plasmodium cynomolgi: PCYB_051790Help
Entry
PCYB_051790       CDS       T02490                                 

Definition
histone acetyltransferase Gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pcy  Plasmodium cynomolgi
Brite
Enzymes [BR:pcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PCYB_051790
Transcription machinery [BR:pcy03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PCYB_051790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1472 aa AA seqDB search
MHFESGGGVANLLQSYTPDGGGHGLTHIDSLEDPPRGSATQSVKSSTPVGASPGSPAGDK
KNEQKSEPKDAWVFAWKKLRTGHLDSLEESSHASGYAVPPIGRVDPSEENDGARSQREKE
GGDVTTTATALLPLLQIEKDVEGEESSDDPPVSGTEWHAIVGADKLVELPKRWQARSCMA
EGNDCSGGDGAGNSSNGGGNAGGSSGDDGKGNGNRGNGHMDGGHQEDNQQEEDDEKKKNE
QRKRKNGEDTIQGGITNGDNGLNLGVDPKMNYFPNGNGMVNGGLGIGGMGSGSPYGSGHN
ELLDQDRVVANGQRKIPAGGNYSNSSSSMSKVESSPVKFSAPNKIPLQSLGGAIGNGSLM
NGAKFSVEGASVKNGTTLAGNKNLGMNSLSGAMGSANMSFPKNKPFMANPQMGFVSNVNG
GGSKGSRMNNMGEVSRMGDASRMGEASRMGEVSRMGEASRMNGPNCKDMNDECSPESKKK
DTGKKEIMDGPLKNSDMNSYPNGAIGMGSNNMNMLPSHGMNNSNAFLNSNMGRMNSLNAF
KGIGNQYNAINIPPMMGGAGGNSYSFHVPPPHPYAGMNLMNSMGMMGSGVGNAAGIGGGF
LPGGPMNEMHAGVMGGLASGMPNGLASGMANGLAGSMANGLAGSMANGLASGMMNGLVNG
PHGSIPLVNSPSRAASATQAAGPKGTRNVGTKSVGGNGTETENGKKNNDTHSNSRGANKM
NSNNESNKNGIKNIRMEDLTFNESVYLKNVDGLDLSKNFVNGKYCSKLPSNEKIYNIVSY
IVENSLVDYLLEFYNNESLLYNEKSELSDGNSGVDNSPRGDELKGVTQDEQEAEKESSPN
VKVEIGEENKAEVCEGGETLNGDNAKETVKKQDEGVADEGIADEGVADERVADGATPEKP
AEGQTDKEHDSVLTPGEQLKEECTPSQTNKKNVPSENISVNNRNEEKLDAAEVKETPNKG
ETATITGISGSGGGSVGREADESNKFILTEITKSICSIINLQQLMPVNNRLSNPNLIYDP
NYDTIYSKWKTFLRKEQSCGNVISMCFSRDFLHTVLLCNYVTIIEDLKKTAVKKKIKYFF
LNLCLEAGLSVDVALMLFINAAKQSNKLQSLLPSETGLGYLHRDAGGAKEENMGIITFEC
ITNDREPDHLIKLITLKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKNTVIGGVCFRP
YFEQRFAEIAFLAVTSTEQVKGYGTRLMNHLKEHVKKFGIEYFLTYADNFAIGYFRKQGF
SQKISMPKERWFGYIKDYDGGTLMECYIFPNINYLRLSEMLYEQKKTVKKAIHFIKPQII
FKGLNFFVQNKGVNNGIHPSNIPGLLEVGWKKEVKYFPKKAQNKDVQLKDQILGVLDFLE
KQQSAWPFLKPVSLSEAPDYYDIIKEPTDILTMRRKARHGEYKTKEDFGIELKRMFDNCR
LYNAPTTIYFKYANELQALIWPKYECITDVGK
NT seq 4419 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcgagtccggcggcggggttgccaacctcctgcagagttacacccccgatggt
gggggccacggcttgacccacattgacagtttggaagacccaccacgtggcagtgccact
cagagtgtcaaaagtagcacccccgttggagcttccccgggtagtcccgcaggtgataaa
aagaatgagcaaaaaagcgagccaaaagatgcgtgggtttttgcatggaagaagctgagg
accggccatttggatagcctggaggaatcatcccacgcgagtggatacgcggtgccgccc
attggacgtgtagacccaagcgaagagaatgatggggctcgttcgcagagggagaaagaa
ggaggagatgttacaaccacggccactgcactgttgccattattgcagattgaaaaagat
gtagaaggggaggagtctagtgatgatcccccagttagtggcacggagtggcatgccatc
gtcggggcagataaattggtggagttgcccaaaaggtggcaggccaggagttgcatggcg
gaagggaacgactgcagtgggggagatggagcaggcaactcgtctaacggtggtggaaac
gcaggggggagcagtggagacgacgggaaaggaaatgggaaccgtggaaatggacacatg
gatggtggccaccaggaggataaccagcaggaggaggacgacgagaagaagaagaacgaa
cagaggaaacgcaaaaacggcgaagacaccatacaggggggtattacaaacggtgataat
ggtttgaacttgggggtggaccccaaaatgaattacttcccaaacgggaatggaatggtt
aatggggggttaggcatcggaggaatgggtagcggctccccttatggcagtggtcacaac
gaactgcttgaccaggacagagtagtagctaatggtcaaaggaaaataccagcaggtggt
aattacagcaacagtagcagcagcatgagcaaggtggagagtagccctgtcaaattttcc
gcccctaataagataccgctacagagtctgggcggtgcgattgggaatgggtccctcatg
aatggggcgaaatttagcgtggaaggtgcaagtgtcaaaaacgggaccaccctggcggga
aacaaaaatttaggtatgaacagtttgagtggtgcgatgggtagtgccaatatgagcttc
cccaagaataaaccctttatggcgaatccgcaaatggggtttgtgagcaacgtgaatggg
ggtggctccaaggggtcgcgaatgaacaacatgggagaagttagccgaatgggcgacgcc
agccgaatgggtgaagccagccgaatgggggaagtcagccgaatgggcgaagccagccga
atgaatggtccgaactgcaaagacatgaacgatgagtgctccccggagagcaaaaaaaaa
gacacagggaagaaagaaattatggacggaccattaaaaaatagcgacatgaatagctat
cccaatggtgccatcggcatgggaagcaacaacatgaatatgcttccatctcatggaatg
aataactcgaatgcatttttaaacagcaacatgggtagaatgaacagcctgaatgcattt
aaaggaattggcaatcaatacaatgcaataaatataccaccgatgatgggtggtgcaggt
ggtaactcttacagcttccatgttcctcctccccatccgtatgctggcatgaatttgatg
aattctatggggatgatggggagtggtgtagggaacgccgccggcattggaggtggcttt
ttgcccggaggtcccatgaacgagatgcacgcgggggtgatgggcgggttggccagcggc
atgccgaacgggttggctagcggcatggcgaacgggttggctggcagcatggcgaacggg
ctggctggcagcatggcgaacgggctggctagcggcatgatgaacggtttggtgaacggc
ccgcatgggagtatccccctggtgaacagcccaagcagggcagccagcgcgacgcaagca
gcggggcccaagggaaccaggaatgtaggtaccaaaagtgtaggtggaaacggaacagaa
acagaaaatggaaaaaaaaataatgacactcattctaacagtagaggtgcaaacaaaatg
aatagcaataacgaaagtaacaaaaacggaattaaaaatatccgaatggaggatctcacc
tttaatgaaagcgtatatttaaaaaacgttgatggtcttgatttgagcaaaaattttgtg
aatggaaagtactgctccaagttgccatctaatgaaaaaatctacaacattgtcagctac
attgtggagaattccctcgtggattatttgctggagttttataacaacgagagtttgctt
tataatgagaagtccgagctgtcggatggcaacagtggggtggataacagcccaagggga
gacgaactgaagggtgtcactcaggacgagcaggaggcagaaaaggagagttccccgaac
gtgaaggtagaaatcggagaggagaacaaagcggaagtgtgcgaggggggagagaccctg
aatggtgacaatgcgaaggaaacggttaagaagcaggacgagggggtcgcagatgagggg
atcgccgacgagggggttgccgacgagagggttgccgacggagctaccccagagaagcca
gcagaaggacagacggacaaagagcatgactctgtgctgaccccaggtgagcagctcaag
gaggagtgcacccccagtcagacgaataaaaaaaacgtcccaagtgagaacatcagtgtt
aataacaggaatgaggagaagcttgacgcggcggaggtgaaggagaccccaaacaaggga
gagaccgccacaatcactggtattagcggcagtggtgggggcagcgtggggcgcgaagcg
gacgaaagcaacaagttcatcctgaccgaaataacgaagagtatatgctccataataaat
ctacaacaactgatgccagtcaacaacagattaagcaacccgaatttgatttatgatcca
aattatgataccatttattcaaaatggaaaacttttttgaggaaagagcagtcctgtgga
aatgttatcagcatgtgtttctcgagagattttttgcacaccgttttgctgtgtaattat
gtgacaataattgaggatttaaagaagaccgctgtgaagaagaaaataaaatattttttt
ctgaacctctgcctggaggccgggctgtccgtcgacgtcgccctcatgcttttcatcaac
gcggccaagcagagcaacaagttgcagtccctcctgccatctgaaaccggccttggatat
ctgcatcgagacgcaggaggagccaaagaagaaaatatgggtatcatcaccttcgagtgc
ataacgaatgaccgagaaccggatcacttaatcaagctgattacattgaaaaatattttc
tccaggcagttacccaagatgcctcgagagtatatcgttcgattagttttcgatcgaaat
cattacacgttttgccttttaaaaaagaacacagtaattgggggagtctgttttagacct
tactttgagcagagatttgctgaaattgcgtttctcgcggttacctcaacggagcaggtg
aagggctacggcacgaggttgatgaaccatctgaaggagcacgtgaagaaattcggcatc
gagtacttcttgacgtatgcggacaacttcgccatcgggtacttccgcaagcaggggttc
tcccaaaaaatttccatgccgaaggagagatggtttggttacattaaggactacgacgga
ggaacgctaatggagtgttatattttcccgaacataaattatctgcgcttatcggagatg
ttatacgagcagaagaagaccgtaaaaaaggctatccattttattaagccacaaattatt
tttaaaggacttaacttctttgtacaaaataaaggagttaataatggcattcacccgagt
aacatccctgggttgctggaagtcggatggaaaaaggaagtgaaatatttcccaaagaag
gcgcagaacaaggatgtacagctgaaggatcagattttaggcgttttggacttcctcgaa
aagcaacagtctgcttggcccttcctcaaacctgtgagcctgtcggaggcacccgactac
tacgacattataaaggagcccacggatattttgaccatgaggaggaaggccagacatggc
gagtacaaaacaaaggaggacttcggaattgagctgaagcgcatgttcgacaactgccgc
ctgtacaacgcgcccacgaccatctacttcaagtacgccaacgagttgcaggcgcttata
tggcccaagtacgagtgtataactgatgtaggaaagtga

DBGET integrated database retrieval system