KEGG   Plasmodium cynomolgi: PCYB_053070Help
Entry
PCYB_053070       CDS       T02490                                 

Definition
histone acetyltransferase
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pcy  Plasmodium cynomolgi
Brite
Enzymes [BR:pcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PCYB_053070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1313 aa AA seqDB search
MKPKCSNKSSIASAEESKNEEIDREYYSCIKNCATDLQNLSLNFFPSINTYTCIPKINAI
NSITFHPCISSRDYFNNTYSFKPLFTHHFFSDSEQVIGFDSLKIDFYYTCDSYEVFMKLS
GSICDQYENSNYIMLMLLQSLYITTPYPGGFIETEEEFLRILRRNEGVERNEQSKGKEKA
KASSTNQSDALTQEKIYKPPGVIIYEKRLSDDIYLQIRKCGFSSKYFKLESVDCIYGEEE
EEEEEEEEEEEEEEKLGGQDGGVYQNGGTNVVQNGSTNVVQHGSTITVQHGSANTVQHGS
TNAVQSEMTLCKDQPCGPPKNDRSKQKKGNPVKETKSENKTSTKGGEINNTSVNPSYQHN
IKGGFSNEPCEDDKKGEGNEADTSNYITNDDNCGSSTMSNELNKEITTRKKRNSKTFFVA
SCTGSNEESISHKEKIKKEKKAKEVLPTSTEIGSAGCDNDNSLVESKKAKKNLTKYVTER
DMSKLYRHYLRVVRAKRRNSLIARGDTQNEKTSAGKKMERQNCSGGSSLGTVAVTAAGSG
GPEAGEADEGSAPNQPGVAAESEAALNSAAAPDSSSPMKGSPPMKGNSPMKGSSPMKGSS
PKKGSPPKKGSPPKKTGSPNQRVSANKGGAPNQPIEPPIENAPHEKETNSRKKKNVRDEL
LGAKYDYTVKNNFELLHRKVEWFYHWFIESASNIEYDYRWSVILPYIVFKHDEEKKFTEN
KFIENLNVQLLKNRTSNVSIIPSIKLDPVPPPSVATNNKEGCLPTGKEVEAGNKKKLKRG
ATAGVKEKKEVKKRKKGQGGGEEVGDEGGGEEGEGGEGVGGEGREEGREEGAGGGGEGNP
EEQTYECKREVHPVASCESEKANDEQRGGREQHEVMVKKESQDEKKKKKNAKGSSKEGEK
IQESYNVEHMESMFDPNEYVLTSEIVIKAIENTMKDVRGKDEEEYYSFHNNYDVIYLYSD
LEKGVGEATIGAVENFTAATDVKGEKKTKGRKGSVAERRKEIHLKEEEMVKGVTDEQDGE
KKRKKGKDKSKEKDRDKDKDKNMDKNKDQNMDKNVDKSVDKSVDKNVDKNKDTDKKQSLY
YFYLFGLATTYTFFTFQFDRNRISQFLIFPPMQSKGLGMKVLEKIYHLSIVNSNVKEITV
EDPAVSFTQLRDIITIKMCIDLRILSPTILYPSDYLKTKNIDKEYAELDKKKFMKVCKET
HKQITRMIETLLLAGVLPHPAPCYADIGEDKTSGVRKKEKKNESPDCVNSMEHFESSDLC
KDVRIKIKKRIKNDYIGNLINKNMNCMASDVFQDYVKEELYKLWKKQCKVYYR
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccaagtgtagcaacaaatcatctatagctagtgctgaggaaagtaaaaatgaa
gaaatcgacagggagtattacagttgtataaaaaactgtgccactgatttgcagaattta
tctttaaatttttttccctcaataaatacgtacacttgcattcccaaaattaatgccata
aattcgataacttttcacccatgcatttcgagtcgagattattttaataacacgtactca
ttcaagccgttgttcactcaccacttctttagtgacagcgagcaggtcatcgggttcgac
agtctcaaaatagacttctactacacctgtgacagttacgaagtgttcatgaaattaagc
gggtccatatgtgaccagtatgaaaattcaaactacatcatgttgatgcttttgcaaagc
ttgtacattacgactccttaccctggtgggttcatcgagacagaggaggaatttctaagg
attctcagaagaaacgaaggggtggaacgaaatgaacaaagcaaagggaaggagaaggcc
aaagcgagcagtaccaaccaaagtgatgcactaactcaagaaaaaatttacaaacctcca
ggggttatcatttacgaaaaaagactcagtgatgatatttatttgcaaataaggaagtgt
gggttttcttcgaaatattttaaattagaaagtgtggactgtatttacggggaggaggag
gaggaggaggaagaggaggaagaagaggaagaagaggaggagaaactgggaggccaagac
gggggtgtctatcagaatggaggtactaacgtggttcagaatggaagtactaacgtggtt
cagcatggaagtactatcacggttcaacatggaagtgctaacacggttcaacatggaagt
actaacgcggttcaaagtgagatgaccctttgtaaggatcaaccctgtggcccccccaaa
aatgacaggagtaaacaaaaaaaggggaacccagttaaggagacaaagagtgagaataag
accagtaccaaaggaggagaaattaacaacacatccgtaaatcctagttaccaacataac
ataaaggggggattttcaaatgagccatgtgaggatgacaagaagggtgaagggaacgaa
gctgacacgtcaaattacatcacgaatgatgataactgtgggagtagcacgatgtctaac
gaattaaataaagaaatcaccaccaggaagaaaaggaactcgaagacgttcttcgttgcc
tcgtgcacaggaagcaacgaagagtccatatcgcacaaggaaaagataaaaaaagaaaag
aaggcaaaggaggtgctccccacgagcactgaaattggtagcgctggttgtgataatgat
aactccctcgtcgaatcgaagaaggcaaaaaagaacctcacgaaatatgttaccgagagg
gacatgtctaagctttaccgacactatttgcgtgtcgtgagggccaagaggagaaacagc
ctcatcgctaggggtgacacccagaatgagaagacctccgctgggaaaaagatggagagg
cagaactgttcgggagggtcctcgctgggaaccgttgctgtaactgcggctgggtcgggg
gggccggaggcaggagaggcggacgaggggagcgcaccgaaccagccaggtgtagccgcc
gagtcggaagcggctctcaattcggcggcggctcccgattcgagttctccaatgaaaggg
agccctccaatgaaagggaactctccaatgaaagggagctctccaatgaaagggagctct
ccaaagaaagggagccctccaaagaaagggagccctccaaaaaaaacgggttcaccgaac
cagcgagtgtcagcaaataagggtggtgctcccaaccaaccgatagagccccccatcgag
aacgcaccccatgagaaagaaacaaacagcaggaagaaaaaaaacgttagagatgaactc
cttggggccaagtacgactacacagttaagaacaactttgagcttctccacagaaaggtc
gagtggttctatcactggttcatcgaaagtgcatcaaacattgagtacgattatcggtgg
agcgtcatattgccatacatagtgttcaagcatgatgaggagaaaaagttcacagaaaat
aaattcatcgagaatttaaacgtgcagcttcttaaaaacagaacctctaatgttagcatt
attccaagtatcaagttagaccctgtgccccccccaagtgttgcaacgaataacaaggaa
gggtgtctcccaaccgggaaggaggtagaggctgggaataagaagaagcttaagagagga
gcaacagctggggtgaaggaaaagaaggaagttaagaaaaggaagaaaggtcaaggagga
ggggaggaagtaggggatgaaggaggaggagaagaaggcgaaggaggagaaggcgtagga
ggagaaggcagagaagaaggcagagaagaaggcgcaggaggggggggtgaagggaaccca
gaagagcagacatacgagtgtaagcgagaggttcaccctgtcgcatcgtgtgaaagtgaa
aaagcgaatgatgagcaaaggggagggagggagcaacacgaagtaatggtgaagaaggaa
agccaggatgagaaaaagaagaaaaaaaacgcaaagggtagcagtaaagaaggagaaaaa
attcaagagagttacaacgttgaacacatggaatcgatgtttgacccaaacgagtacgtc
cttacgagtgagattgtcattaaagcgattgaaaacaccatgaaggatgtacgaggtaag
gacgaggaggagtattactcattccacaataattacgatgtcatttatttgtactccgat
ttggagaaaggagtgggtgaggcgaccataggggcagtagaaaatttcacagcagcaacc
gacgtgaagggagagaagaaaacaaaagggaggaaagggtccgtggcggaaaggaggaaa
gaaatacacctcaaggaggaggaaatggtgaagggcgtaacagatgagcaagacggagaa
aaaaaaaggaaaaaaggtaaagataaaagtaaagagaaagatagggataaagataaggat
aaaaatatggacaaaaataaagatcaaaatatggacaaaaatgtggacaaaagtgtggac
aaaagtgtggacaaaaatgtggacaaaaataaggacacggataaaaagcaaagcctgtac
tatttttacctattcggattggcgacgacctacaccttttttaccttccaatttgatcga
aaccggatttcccaatttttaattttcccaccgatgcagagtaaaggactaggaatgaaa
gtgctagaaaaaatttatcacctatctatagtcaactcaaatgtgaaagaaattactgta
gaggatccagccgtttcgttcacccagttgagggatatcatcacgattaaaatgtgtatc
gatttgagaattctgagccccactattctctacccaagtgattatttgaaaacaaaaaat
attgacaaggagtatgccgaattggataaaaaaaaatttatgaaagtatgcaaagagaca
cataaacagattactaggatgattgagactttattgttggctggtgttttaccacaccct
gccccgtgctatgctgatattggggaagacaaaacctcgggtgttaggaagaaggagaag
aagaacgaaagtcctgactgcgtcaattctatggaacatttcgagtcctccgacttgtgc
aaagatgtgcgcatcaagattaagaaacgaattaagaatgattacatcgggaatttgatt
aataagaatatgaactgcatggcgagcgacgtcttccaggactacgtgaaggaagagctt
tacaaactttggaaaaagcagtgcaaagtctactacaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system