KEGG   Plasmodium cynomolgi: PCYB_062220Help
Entry
PCYB_062220       CDS       T02490                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pcy  Plasmodium cynomolgi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCYB_062220
Enzymes [BR:pcy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PCYB_062220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 416 aa AA seqDB search
MGAREGGGEAGVPAGGGEAGLAAEPGGANASCGVSTSSTSRTSIEPEEPDEDPPNEQHTY
DVIIIGGGLFSCCLYYFLKRKNRDIKILILEKEQTLGGYIKTEWLEDQGKNFLCELGPNI
FKISEESYQLLNELNLLSHVRVLNRKLLSVTNKVKLIYKLLFKRYKELRAYDEDISVEEY
MRENFDLQHYNFLLLPLIYGSCGGVGSISAVSFFSRNLKLFDNKLNTLRVWQERMGGGVC
RVDSLSRGEVGCDAPPPNEEKTPNREKHISVSLQHSCAQRMNQKYDLSSSFNNNVLHTQD
MPSGDTMGDTAEGDTLGGDLIGRANTNGEASHEHANGSHENSSPANVECTTKHHAGMDTM
KSQPDFMDTPAVEMFLHFVKRIYAKCKCAILQAIPLLYTQLAKKGSKEYEQKKKKS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgcgcgaagggggaggagaggcgggcgtgccggctggagggggggaagctggc
ctcgcggccgagccaggcggggcaaacgcgtcatgtggggtaagcacgtcaagcacgtca
agaacgtcaatcgagccagaggagccagacgaagacccccccaacgaacagcacacgtac
gatgttatcatcataggcggaggactcttcagttgttgcctatactactttctaaagaga
aaaaatagagatataaaaatcttgatactggaaaaggagcaaacactcggagggtatata
aaaacagaatggctagaagatcaagggaagaatttcctctgcgagttgggcccaaatatt
tttaaaatatctgaggagagttaccagctactcaacgaattaaacctgttgtcacacgta
agggtcctaaatagaaagctcctaagtgtcaccaataaagtgaagttaatttacaagctc
ctatttaagaggtacaaagaattgagagcgtacgatgaggacattagtgtcgaagagtac
atgagggaaaacttcgatttgcaacactacaactttttgttgttacctttaatttatgga
tcatgtgggggtgtagggagtatttcggctgtttcttttttttcgcgtaatctcaaactg
ttcgataataaactgaacacgttgcgtgtgtggcaggagcgcatggggggtggagtgtgc
agagtggatagcctgagcagaggtgaagttggctgtgatgctcctccccccaacgaagaa
aagacgccaaaccgagagaaacacatctccgtgagcctacaacactcctgtgcgcaaaga
atgaatcagaagtacgacctctcctcctccttcaacaacaacgtgctgcacacacaggac
atgcccagcggagacaccatgggggacacagctgaaggggataccctagggggggactta
attggcagggcgaacacaaacggggaggcgagccacgagcacgcgaatggcagtcacgag
aatagcagcccagcgaatgttgaatgcacaactaagcaccacgcagggatggacaccatg
aagagccagcctgattttatggatacccccgccgtggaaatgttcctccacttcgtaaag
cgaatttacgcaaagtgcaaatgcgccatcctccaggccataccgctgctctatacccag
ctagccaaaaagggctccaaggaatatgaacaaaaaaaaaaaaaatcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system