KEGG   Plasmodium cynomolgi: PCYB_071440Help
Entry
PCYB_071440       CDS       T02490                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pcy  Plasmodium cynomolgi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCYB_071440
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PCYB_071440
Enzymes [BR:pcy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PCYB_071440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 434 aa AA seqDB search
MKQQTPTVSPSKMIECIENYLKTFKEKENMYVKKKVSIIGSPLSAGQPLGGVHLACDNLR
MLGLHKVIEALGWSYEDVGNIDTGGSGGSVSSSGSTVDKDIVWGRTDEQTEMNGTLNTHN
RSYAHTEKYHYGMEKMNGDTKLNHCCNGKDNANWENHSDINDHGGGGYMTKMCVQNNYYN
NIKNVEIIGKFGEKLFRTMSKELRKKNFVLNIGGDHSVAFPSILSSLQFYRDLRVIWIDA
HGDINIPETSPSGNYHGMALAHTIGLFKNKVPCFEWSENLTYLKPENVAIIGIRDIDMYE
KIILKKCNINYYTIFDIEKNGIYNTICTALNLLDPHENCPIHVSLDIDSVDSFFAPGTGT
IAKGGLNYREINLLMKVLADTRRIVSMDLVEYNPSLDENDKMVHSDSLPISEYATKTGKL
CLELIARVLGNDIV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcagacaccaactgtatcccccagcaaaatgattgaatgtatcgagaattat
ttaaaaacgtttaaggagaaggaaaacatgtatgtgaaaaaaaaagtgtccataattggg
tcccccttgtcggcgggacagcccttgggaggagtgcacctggcttgtgacaatttaagg
atgctcggtttgcacaaggtgatagaggccttgggttggagttacgaagacgttggaaat
attgatactggtggaagtggaggaagtgttagcagcagtggaagtactgtagacaaggat
atcgtctgggggaggactgacgaacagaccgaaatgaacggaacgctaaacacgcacaac
aggagctatgcacacacggagaagtaccattacggaatggaaaaaatgaacggagacaca
aaattaaaccactgctgcaatggaaaagataatgccaattgggaaaatcatagtgacatt
aatgaccacggggggggaggatacatgaccaaaatgtgcgtacaaaataactactataat
aatataaaaaatgttgaaattattggaaaatttggtgaaaaattatttcgcacaatgagt
aaagaattgaggaagaaaaattttgtattaaacattggaggtgaccacagcgttgcattt
ccaagcattctgagctctttgcaattttaccgagatttaagagtcatatggatagatgcc
catggagacattaacatcccggagacctctccttcaggaaattatcatggcatggcatta
gctcacaccatagggctctttaaaaacaaagtgccatgcttcgaatggtctgaaaatctc
acatatttaaaaccagaaaatgtggctatcattggaatacgagatatcgatatgtatgaa
aaaattatcttaaaaaaatgtaacattaattattatacaatctttgacattgaaaaaaat
ggcatatacaataccatctgtacagctcttaacctgctagatccccatgaaaattgcccc
atacacgtttctctcgacatagatagtgtcgatagtttttttgccccaggaactggaacc
attgccaaggggggcctaaattatagagaaattaatttattaatgaaagtcctggcagac
acaaggcgcatcgtttcaatggatttagtagaatataacccatctctcgacgaaaatgat
aaaatggttcacagcgattccttacccatttctgagtatgccacaaaaacgggcaagctt
tgtctggagcttattgccagggttctcggcaacgacatcgtctag

DBGET integrated database retrieval system