KEGG   Plasmodium cynomolgi: PCYB_072010Help
Entry
PCYB_072010       CDS       T02490                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pcy  Plasmodium cynomolgi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCYB_072010
Enzymes [BR:pcy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PCYB_072010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 445 aa AA seqDB search
MKNCVIFLFLFCACIKYVSCHADQIINQKLTDLVFLSCNYQKGKKNETLIKSVEKRKPQL
MLWVGDYFYSNCKDLKCLHEVYDYIKKDPFYIGLKKKFVIDGIYDDHDYNKNNGDRLYEH
KKESKTQYLNYLNVPKNDVRYKRNGAYISKLYVDPENEKNQVKIIILDTRYNKDPYPFYA
PDSYHDSLMHMFVSFVVRFHVALFGLHCDSKNDILGNEQWAWLEKELTNSSARAHIVISS
TQIFSNHIVNENWGLMPFAQKRLKHLMNKTKPKGLIFLSGDVHFASIIGNEENVLEVTSS
SVNQENIFSYINKYFIYFSTNFLNKKSPFELNNIFAFNNFGSLKISYVNDNEIKIKSVIH
DSDGNEIIVANQTFNNKKNVYQKTQNLHLLHDDIATFTCKSNAKVCIHVIIYILFVLWFL
QIIFIFCKLLGFCKKKKVADKTKGE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtaattttcctttttctgttttgcgcatgtatcaagtatgtgagttgc
catgcggatcaaataattaaccaaaaattgactgacctggtttttttgagttgtaattat
caaaaggggaagaaaaatgagacgttaataaaatcggtggagaagaggaagccacaactt
atgctctgggttggagattatttttactcaaattgtaaagacttgaaatgcctgcacgaa
gtgtatgattatattaagaaggatcccttctacatagggttaaaaaaaaagtttgtaatt
gacggcatatatgatgatcatgattataataaaaataatggagatcgactgtatgagcat
aagaaggaaagcaaaacgcagtacctaaattatctgaatgtgccaaaaaatgacgtgagg
tacaaacggaatggtgcatacatttcgaaattgtatgtagacccggagaatgaaaagaat
caagtgaaaattatcattttagacaccagatataacaaagacccgtaccccttttatgcg
cctgactcataccatgacagtcttatgcatatgttcgtttcgttcgttgttcgctttcac
gttgctctgttcggtctacactgcgacagcaagaatgacattttgggcaatgagcagtgg
gcgtggctggagaaggagctcaccaactcgagtgcgcgcgcgcacattgtcatttcgtcc
acgcagattttctccaaccatatcgtgaacgagaattggggattaatgccattcgcccag
aagcgactaaaacatttgatgaataaaaccaagccaaaggggttaatcttcctaagtggt
gatgtgcactttgcaagcataattggaaacgaagaaaatgtgctggaagtcacaagcagt
agcgtaaaccaggagaacatatttagctacatcaacaagtatttcatttatttctccact
aattttctaaacaagaagagtcccttcgagttaaacaacatatttgcatttaacaatttt
ggctcacttaaaatatcatacgtaaacgacaacgaaataaaaataaaatccgtaattcat
gactcggatggcaatgaaattatagtggccaaccaaacgtttaataataaaaaaaacgtg
tatcagaaaacacagaacttacatttattgcacgatgacatagcgacgttcacgtgtaag
agcaatgcaaaggtgtgtatacacgtcataatttacatactgtttgtgttgtggtttttg
caaattattttcatcttttgtaagctgctcggattttgtaagaaaaagaaggtcgcagac
aaaacgaagggtgagtaa

DBGET integrated database retrieval system