KEGG   Plasmodium cynomolgi: PCYB_073080Help
Entry
PCYB_073080       CDS       T02490                                 

Definition
NADPH-cytochrome p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pcy  Plasmodium cynomolgi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 739 aa AA seqDB search
MNPRASRLLLQGSIFCACAVFLAWKTRHSPLFRKVTNIVRRFLHLKSQRDIETNDQIRNN
VKIYFGSQGGTAEQFSKELSKNLSDIFKIKAEIIDLEYFNKEEISKFGWLKILNDDNEYF
RNTIYSIMGLGSKQYKHFNKVAKKLANYLTKFKAKQISENVFGDDDDNIYQDFEIWKSKF
FKELVKMLHMKEEIIPAQFVSENVVELVDWTTLPEINLRIRYEGEEEAAVPAASVEGEEA
AVPAAAVEELAVAAEDALPHGLQETHPGEKEPTILPHQTTDITGKFYFNHQRGRVISNEN
LLKNVNDTSDDDKVNRIVIAVEKVSFKAADTFVVLTKNPRQVVSWWLKRLGLDDTDRKKR
FTFVSRNTTEKNHSPESPHSNSNLNALPGSSPQEIPPLCVPFPTPCTVEDALAYYCDLTT
IPRVNILKKFSCFIKDVEELKMFNYLLSNKQRSTFFNICKESDMTLIEFVDIFMPQAKFE
LTPFLQLIPRNVPKSYTISSSPKEAEDTISLTVKKKQYPIHSLRKALKGFKNNDMLPPIS
EQKLRELCSRRWFKGSSSFYLTEELAPHDSVKFNLKSSKFCLPPYLESTNIIMVATGTGI
APFKAFITEFKHFDQMCVQNGVVKKAKRILFFGCRKKEIDFLYEREIAEAEEGKHVDQVF
LAFSRDQHEKVYVQDLILERKDLVWSLIQKGAYIYVCGNSNMSKDVNKTINSLPMHYKQN
NKKFTKSLKKAGRYVEEMW
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcgggcgagcaggctccttttgcaggggtccattttctgcgcgtgcgcagtg
ttcctcgcctggaagaccaggcactcccccctttttcgaaaagtgacaaatatcgtaaga
agattcctccacttgaaaagtcaaagggacattgagacaaacgaccaaattaggaacaac
gtgaaaatctactttggtagccaaggaggaactgcggagcagttttccaaagaactaagc
aaaaacttaagtgacattttcaaaataaaagcagagataatcgacttggaatatttcaac
aaggaagagatatcaaaatttggatggctcaaaattctgaatgacgacaatgaatatttt
agaaatacgatatattctatcatgggattaggaagcaaacaatataagcactttaacaag
gttgcgaaaaagctagccaattatctcaccaaatttaaggcaaaacagattagcgaaaat
gtgtttggggatgatgatgacaatatatatcaggactttgaaatttggaaaagcaaattt
tttaaagaacttgtaaaaatgctacatatgaaggaggaaattattccagcacaatttgtc
tcagaaaatgtggtcgagttggtggactggacgacccttccagagataaatctccgcatt
cggtacgaaggggaagaggaagcggcagtgccagcggcatcggtagagggagaggaagcg
gcagtgccagcagcagcggtagaggaattggcagtggcagcggaagacgcgttgccacat
gggctgcaagaaacacaccccggtgaaaaggagccaacaattttgcctcaccaaacgacc
gacataacgggcaagttctactttaatcatcaaaggggaagggtcatatcgaatgagaac
ctgttgaaaaatgtgaacgacacttctgacgatgataaggtaaatcgtatagttatcgct
gtggagaaagtctccttcaaagcagctgacacgtttgttgtgttgacgaaaaacccgagg
caagtcgtctcctggtggttgaagcggttaggcctagacgatacagacaggaaaaagaga
ttcacctttgtgtctaggaacacaacagagaagaatcactccccagaatctccccacagc
aattcgaatttgaatgccttaccaggaagttcaccacaggaaatcccccccttgtgtgtc
cccttccccacgccatgcactgtggaagatgcactggcatactactgcgacttgacgacc
ataccgagggtgaacattttaaagaaattcagttgcttcattaaagatgtggaagaactc
aaaatgttcaattatctcctttccaataaacagagaagtacgttcttcaacatttgcaaa
gagtcagacatgaccttgattgaatttgttgatatattcatgccccaagctaagttcgag
ttaaccccgtttttgcaactaattccaaggaatgttcccaaaagttacaccatttcttca
tcccccaaggaagcggaagacacgatatctttaaccgttaagaagaaacagtaccctatt
cattcccttcggaaggctctgaaagggtttaaaaataacgatatgcttccccccataagt
gagcagaagttacgagaactttgcagcaggcgatggtttaaaggttcatcctccttttac
ctaacggaggaattagccccacatgatagcgtaaaatttaatttgaaatcttccaaattt
tgtttgcccccctatttggaatcgaccaatattatcatggtcgctactggaacgggaatt
gcccccttcaaagcgttcataacggaatttaagcatttcgaccaaatgtgtgtgcaaaat
ggagtagtcaagaaggccaaacgaatactcttcttcggatgcagaaagaaagaaatagac
ttcctctacgaaagggaaattgcggaagctgaggaagggaagcatgttgatcaagtgttc
cttgctttctcaagagatcaacatgaaaaggtttatgtgcaggatttaattctggaaagg
aaggatcttgtatggagtttgatccaaaagggggcctacatctacgtttgtggcaatagc
aacatgagcaaagatgtgaacaaaacgattaacagcttgcccatgcattacaaacaaaac
aataagaaatttaccaaaagtttgaagaaggctgggcggtatgtggaagaaatgtggtga

DBGET integrated database retrieval system