KEGG   Plasmodium cynomolgi: PCYB_073330Help
Entry
PCYB_073330       CDS       T02490                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pcy  Plasmodium cynomolgi
Brite
Enzymes [BR:pcy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PCYB_073330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 421 aa AA seqDB search
MKPQRIRMTHSLIVSYNLYKYMEVYRPHKSDVNELTLFHDYEYVDFLSSISMENYREFTY
QLKRFNVGEATDCPVFDGLFQFQQSCAGASIDGAAKLNHHCADICVNWSGGLHHAKMSEA
SGFCYINDIVLGILELLKYHARVMYIDIDVHHGDGVEEAFYVTHRVMTVSFHKFGDYFPG
TGDITDIGVHHGKYYSVNVPLNDGITDDAFVDLFKVVIDKCVQTYKPGAIILQCGADSLT
GDRLGRFNLTIKGHARCVEHVRSYNLPLLVLGGGGYTIRNVSRCWAYETGVVLNKHHEMP
DQISLNDYYDYYAPDFQLHLQPSSIPNYNSAEHLSRIKIKIAENLRNIEHAPGVQFAYVP
PDFFDSEIDDECDKNQYELKDDSGGGRAAGTRSKEHSTTHHLRRKNYEDDFFDLSDRDQN
I
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcagagaatccgaatgacgcactcgctaatcgtgtcatataatttgtacaaa
tatatggaagtatacagaccacacaaaagtgacgtaaacgaattgactctctttcatgat
tacgagtatgtagattttttgtcttccatttcgatggaaaattatcgtgagtttacatat
cagttgaagcgatttaatgttggagaagcaacagactgtcctgtgtttgatgggctattt
caatttcagcaatcatgtgcaggtgcatcaatagatggagcagcgaagctaaatcatcac
tgtgctgatatatgtgtaaactggtcaggaggtttacatcatgcaaagatgtcagaggca
agtggcttctgttacattaatgacatagtgctgggaattcttgagttactcaagtaccat
gcacgggtgatgtatatagatatagatgttcatcatggggatggtgtagaagaagcattt
tacgttactcatcgagtgatgacggtttcttttcataaatttggagattacttccccgga
acgggtgatataaccgatataggtgttcatcatggaaagtattacagtgttaatgtacca
ctaaacgatggaataactgacgatgcctttgttgatcttttcaaagtagttatagataag
tgcgtacagacatacaaaccaggagctatcatattacaatgtggtgcagatagtcttact
ggggatagattaggtagatttaatttaaccattaagggacatgctagatgtgtagaacat
gtgcggtcgtataatttacctcttctcgttttaggtggaggagggtatacgattaggaat
gtatctcgatgctgggcatacgaaacgggagtcgtacttaacaagcatcatgagatgcca
gatcagataagcttaaatgattactacgattattatgcgcctgattttcagctacattta
caaccatcaagtattcccaattataactctgctgaacacttgagtcgcataaaaataaaa
atagccgaaaatttgaggaacatagaacatgcgccgggggttcagtttgcttacgtccct
cccgatttcttcgattccgaaattgatgacgagtgtgacaagaaccagtatgagttgaag
gatgatagtggcggcggtcgcgcggcaggcaccaggtccaaggaacactccactacgcac
cacttgcgcaggaagaattacgaggacgattttttcgacctctccgacagggaccagaac
atc

DBGET integrated database retrieval system