KEGG   Plasmodium cynomolgi: PCYB_092320Help
Entry
PCYB_092320       CDS       T02490                                 

Definition
ubiquitin C-terminal hydrolase family 1
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pcy  Plasmodium cynomolgi
Brite
Enzymes [BR:pcy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PCYB_092320
Peptidases [BR:pcy01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PCYB_092320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 450 aa AA seqDB search
RYSNDSLSEWCLIESNPCIFNDMLSRMGAKNLSVEDVYDMDFFDDYICNRDVVSVENVLS
IDEYRSEKEKEENAAVQSTPGETTPHREGPQKKLYNSAVTTEAKYNKLIKNENNIYGIIF
LFNIGKSYNRNKFVEHSVPENLFFAKQVIPNACATQAILSIVLNKEVELNEEIKNIKSFS
NNFDSSMKGLTLSNCNFLRNIHNSYKPPIYIEKENLHDEKGKSNDSFHFVSYIQYGGSVY
MLDGLQEGPVLIGETNGAAGERSWIDLAREHIRKEINDICSGSGKGGGEAGEAGVGGEAG
DGVDGGDGRFSILAVVKDKEHIITEFCNIHRIVKKRVNAKLSSLGKQDVDLNDEINEENF
SYHNIPTIEELPQDIQELLQIAQKSTVEINFLQSLLQEQMQLKLSWNKELTFKFFNFYPF
VMSSLKLMAKHKLLKEAYQKQKQKCRRAAV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
agatacagcaacgacagcctgagtgaatggtgcctaatcgagagcaatccgtgcatcttt
aatgacatgctaagtcggatgggggcgaagaacctctccgtggaggacgtgtatgatatg
gattttttcgatgactacatatgtaacagggatgtggtcagtgtagagaatgtcctcagc
atcgatgagtatcggagtgagaaggagaaggaggagaatgccgctgttcagagtaccccg
ggggagacaaccccgcacagggaaggcccacagaagaagttgtacaacagcgccgtgacg
acagaagccaaatacaacaagctaataaaaaacgaaaacaacatttatggaattattttc
ctgtttaacatcgggaaaagctacaacaggaataagttcgtggagcacagtgtgccggaa
aatcttttttttgcaaagcaggtgatcccaaacgcatgtgctacgcaagctatcctatcc
attgtccttaataaagaggtagaactgaacgaagaaataaaaaacatcaaatcgtttagt
aacaactttgatagctccatgaaggggctcactctttctaactgtaattttcttcgaaat
atccacaactcgtataagcctcccatatatatagaaaaggagaacctacatgatgagaag
ggaaagagcaacgactcgttccacttcgtttcgtatatacaatatggtggaagtgtgtac
atgctggatgggctacaggaggggcccgtgttgattggagagaccaatggcgcagcgggg
gagcgcagttggatcgacctcgccagggaacacataaggaaggaaatcaacgacatatgc
agcggaagcggtaagggaggaggagaagcaggagaagcaggagtcgggggagaagcggga
gacggagtagacgggggagacggccgattcagcatcctagccgtcgtgaaagacaaagaa
cacattatcaccgaattctgtaacatacatagaattgtaaaaaagagagttaacgccaag
ttaagtagcctgggaaagcaggacgtagatctaaacgatgaaataaatgaagaaaatttt
agctaccataatattcctaccatagaggagctcccccaagacatccaagaactccttcaa
attgctcaaaaatcaacagtagaaattaatttccttcagtcccttctgcaggaacagatg
cagctgaagctcagctggaacaaagaactcacttttaaattttttaatttctatccgttt
gttatgtcgtccttaaagctgatggcaaagcataagcttttaaaggaggcttaccagaag
cagaagcagaagtgcaggcgggccgctgtgtag

DBGET integrated database retrieval system