KEGG   Plasmodium cynomolgi: PCYB_094000Help
Entry
PCYB_094000       CDS       T02490                                 

Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pcy  Plasmodium cynomolgi
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PCYB_094000
Enzymes [BR:pcy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PCYB_094000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 401 aa AA seqDB search
MKPVGPLICSLVLLAGLCPRYASGLYTNVKEIKTVESPKEFEELLNDKKVCLVEFYATWC
RASRGFANDFTNIAKTIKDDITILAVKNEDIINQYKIETYPSIHVFFAKDSKKNSEKFDG
NYKIKEVVSFVYDSIKKHRLKELNIDLDDMNKSSYKKKGKKKNDGKVITLNDSNFDNNVL
QDDENVWFVFFYAPWCGHSKPIHPMFDQLAKKVAHLKNARIGKIDATVEQRSAQTYQIRH
YPSFRLFPSGKKKSHSAVEYNDSRTVEDMYQFFLKYYSEKKEVIQLTSQQVFDEYCEKDI
LTNVIKDVSSLPVTLLWTQAGDQLDLVQKLNLTFGFPTVIAISFSKNVYSVLKGNYSEQS
IKNFITQMMMGKSSVDNLVPFTVKTVPKFSFTSAGEANSEL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgtgggccccctaatttgctcgctggtactcctggcgggcctgtgccccagg
tacgcctcgggtctgtacacaaatgtgaaggaaatcaaaacggtggagagccccaaagag
ttcgaggagttgctaaatgacaaaaaagtttgcctagttgaattttacgcaacatggtgc
agagcctccaggggttttgcgaatgactttaccaacatagccaagacgataaaagacgac
ataacaattttggccgtaaaaaatgaagatataattaaccagtacaaaattgaaacatac
ccaagtatacacgttttcttcgcaaaggacagtaaaaaaaatagtgaaaaatttgatggc
aattacaaaataaaagaagtggtttcctttgtatatgatagtataaaaaagcaccgtttg
aaagaactaaatatcgacctcgatgatatgaataaaagttcctataaaaaaaaaggaaag
aaaaaaaacgatggcaaagtaattacactaaatgatagcaattttgataataatgtgtta
caagatgatgagaacgtgtggtttgtctttttctatgctccatggtgtggacacagcaaa
ccgatacacccaatgttcgaccaactagcaaaaaaagtagcacatttgaagaacgcacga
attgggaaaatagacgctacagtggaacaacgatcagcacaaacttatcaaataaggcac
tatccatcttttaggttattcccgtcaggaaagaaaaaatcacatagtgctgtagaatat
aacgactctagaacggtagaggacatgtatcaattttttttaaaatactattcagaaaag
aaggaagtaattcagttaacttcacaacaagtgtttgatgaatattgcgaaaaagacatt
ctgaccaatgttattaaagacgttagtagcttgccagtcactttgctgtggactcaagca
ggagaccaactagaccttgtgcagaagttaaaccttactttcggtttccccactgttata
gccattagcttttcgaaaaatgtctattccgttttgaaggggaattattctgaacagtcc
atcaaaaatttcatcacacaaatgatgatgggcaaatcttctgttgacaatttggttccc
tttacggtgaagacggtccccaagtttagttttaccagcgcgggggaagccaactcggag
ttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system