KEGG   Plasmodium cynomolgi: PCYB_103050Help
Entry
PCYB_103050       CDS       T02490                                 

Definition
stearoyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pcy  Plasmodium cynomolgi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PCYB_103050
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PCYB_103050
Enzymes [BR:pcy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PCYB_103050
Lipid biosynthesis proteins [BR:pcy01004]
 Desaturase
  First
   PCYB_103050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 672 aa AA seqDB search
MIWLSLFFTKLLYTSNDNSKLLHNFSVLSILFHVYYAYMVFVNYIYTYHKQFRSSLFSFI
LFFHIFGIIGMIKLYYHDYGRSLFAQCIIFYLINGFGITFGAHRLWSHRAFKAGTFVQVL
FLILNSFANQGSVITWSKNHRLHHKYSDTKYDPHNIRYGFFYSHVGWLLYQKTKYVKEKE
KEIYVDDLLQNPLLLWQHKLDPYFNFFFCFIVPGIYSYFMYNNFWDGFFILGALRWIITL
HATWSINSASHSFGHRPYNHDIKASNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILS
INPTKYVIQFFYHLGLVWDLKCAQNICKEVRIKEAQKLEKKSKLLSENIKNEILKKEDTS
YVTDLMNSFTALCNDYINISTFRYITYLLRDFAIMMTIFLIHVYYCYNKYGNGTLFSNMS
KNFEAIESNKLISVCSFVFFHIILYALPMGTMFASLYSLVYECKRGLLFKNNFLNNFFGS
IISSFILLPYTSENSRKSLLISLNEDFLKVLKGPIYFDLYSFIFTIFLGLYGLVTYIFGH
FYFLIFFIAPYVVFNVWLLTYIYLLNNPPFFTVDMNAKDVDISVLNYVAFQSLLEWKKNN
SIYQSKKRLYKIVFFFLNFIHHHLCYTHIVEFINSKIPSYRTKEIYKQFDKTLDQYHSLR
NDKFIEVLKQFL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgatatggctgagtctattttttacaaaattactgtacacctctaatgataactcaaaa
ttacttcataatttttcagtcctttctatcttattccacgtatattacgcctacatggtc
ttcgtgaactatatatatacgtaccacaagcagttcagatcctccctattttctttcatt
ttgtttttccatatatttggcataattggcatgatcaagttgtattaccatgattatgga
aggtccttgttcgctcagtgcataatattttacttaataaacggattcggtataacattc
ggcgcgcaccgtctgtggtcccaccgagcatttaaagcgggtaccttcgtgcaggttctc
ttcctaattttgaacagctttgcaaaccaaggaagcgtaataacgtggtccaaaaatcac
cgcctgcatcataagtatagtgatacgaagtacgatccgcataacataagatatgggttc
ttctatagccatgttggatggttattatatcagaagacaaaatatgtaaaggagaaggag
aaagaaatatatgtggatgatttattacagaacccacttctcctatggcaacataaattg
gatccatattttaacttttttttttgtttcattgtaccgggaatatattcctattttatg
tataacaatttctgggacggattcttcattttgggagcactaagatggatcatcacgtta
cacgccacttggtcgatcaacagtgcctcgcattcatttggacatagaccctacaatcat
gatataaaagcttcaaacaacatttttacctccattgtggcgctgggagaaggatgccac
aattaccatcatgttttcccgtactgctatgccatgaacgaaaatttctacattctgagc
ataaacccaactaaatacgtcattcaatttttttaccacttgggattagtatgggattta
aaatgtgcgcagaatatctgcaaggaagtacgcataaaggaagcgcaaaaattagagaag
aaaagcaaattattaagcgaaaatattaaaaatgaaatactgaagaaagaagacacgagc
tatgtaactgacctaatgaactcgttcacagcactttgcaatgactatataaacatctcc
acctttaggtacatcacgtatttattgagagattttgcaataatgatgaccatttttcta
attcatgtatactattgctataacaaatatggaaatggaactttattttcaaacatgtct
aaaaattttgaagccatagagagcaataaactaatttctgtttgctcatttgtatttttt
cacatcatattatatgccctacccatgggaaccatgttcgcaagtctgtattccttggtt
tatgaatgcaagagaggattactttttaaaaacaattttttaaataacttctttggaagt
atcatttcatcttttattcttcttccatatacatcggagaattcgagaaaatcgttgctg
atatcgttgaacgaagattttttaaaagtgttaaaaggacccatttattttgatttgtat
tcattcatatttaccatatttctgggattgtacggactggtcacctacatatttggacac
ttttactttttaatatttttcatagcaccctatgtagtttttaacgtgtggttattaact
tacatttatttgttgaacaatccacccttttttaccgtggacatgaatgcgaaggatgtc
gatataagtgttttaaattacgtggccttccaatccctacttgagtggaaaaagaacaat
tccatttatcaaagcaaaaaaagattgtacaaaatagttttcttcttcttaaattttata
caccatcatttgtgctacacacacattgtagagttcatcaattcgaaaattcccagttac
cgaacgaaggaaatttacaagcagtttgacaaaacattagaccagtatcactccctgcgc
aatgacaaatttattgaagttttgaagcagttcttatga

DBGET integrated database retrieval system