KEGG   Plasmodium cynomolgi: PCYB_111300Help
Entry
PCYB_111300       CDS       T02490                                 

Definition
oxidoreductase NAD-binding domain containing protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pcy  Plasmodium cynomolgi
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PCYB_111300
Enzymes [BR:pcy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PCYB_111300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 365 aa AA seqDB search
MKQTLGEGLNFLSKNVVNIVILVMSISCVLLFVKKNKDGKKKAENLFELYMKANENEELK
GGQEDGYGGGGSMQKAFLDEKSKMLKLNKIVKLTNTVRIFIFSYPWEYTDFGLGICKHIK
FNGPNQQGKIKGKWNDREDREKDAKEIFRSYTPIYVDKKKKEVHFVIRIYSPDKQFVDGG
KMSIHLDKMRNNEMVKIAGPFGVLDYKGSNQFSYLSKAVQIKRHIVMIAGGTGMTPFFRL
IKHMLLFDVRKGEGEQPFVTLIYANRNEEEILLKEVFDEYERTFERFKAVYSIDQCLDPT
KKDTFENVGYLTEDLLRKYILKYQKLDVQVDNSDTLILMCGPPPMTAFLKKILKEDIKME
NVITL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagacgttaggggaaggactaaacttcctctcaaagaatgtagtgaatatcgta
attttagtgatgtccataagttgtgtccttctatttgtaaagaaaaataaagatgggaaa
aaaaaagcagaaaatctttttgaactttatatgaaggcaaatgaaaatgaagagttgaag
ggaggacaggaggatgggtatggtggaggaggatctatgcagaaagccttcctggatgag
aagagtaaaatgttgaagctgaataaaattgtaaagctcactaacacggtgaggatattc
attttttcgtacccatgggagtataccgatttcgggttaggtatatgtaagcatataaaa
tttaacggccctaatcaacaagggaaaataaaaggcaaatggaatgatagggaggacaga
gaaaaggatgcgaaagagattttcagaagttacactcctatttatgtagataaaaaaaag
aaagaggttcattttgtcattcgaatatatagcccagataagcagtttgtggatggtggc
aaaatgagtatccatttggacaaaatgcgaaataatgaaatggttaaaattgcgggtccc
tttggggttttagattataaggggagtaaccaatttagttacctgtccaaggctgtgcag
attaagaggcacatcgttatgatagctgggggaaccggcatgactcccttttttcggctg
ataaagcacatgctcctgtttgacgttaggaagggcgagggggagcagccgttcgtcacg
ctcatatacgccaacaggaacgaggaggagattctactcaaggaggttttcgacgagtac
gagcggaccttcgaacggttcaaagcagtgtacagcatagaccagtgcctggaccccacc
aagaaggacacgttcgaaaatgtaggatacctaacggaggatcttttgcgcaagtacatt
ctcaagtatcagaagctagacgtccaggttgacaacagcgacacgctcattttgatgtgt
ggccctccccctatgacggctttccttaagaagattctgaaggaggacattaaaatggaa
aatgtcataacgctttag

DBGET integrated database retrieval system