KEGG   Plasmodium cynomolgi: PCYB_125460Help
Entry
PCYB_125460       CDS       T02490                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pcy  Plasmodium cynomolgi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 228 aa AA seqDB search
MLRNNIWVPIESNPESLYLYSCKLGQSKLTFQDIYGFDAELLDMIPQPVHAIILLYPLKE
GMSNSNTETDGSTEQNIDNIWFIKQVVPNSCGTVALFHLYGNLKNKFELDKDSLLANFFD
KVKDMTPEKRGQEFEVNKSIELLHHEFSGKASSTGDDIDVDTHFIVFVEIDGRLVELDGR
KDHPVIHCTTTAASFKYDTGNVIQKKFIEKCKDDNRFSALAVVSSDAV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggaacaatatttgggttcccatcgagtccaacccggagtccctctacctttac
tcctgcaaacttggacagtcaaagttgacgtttcaggatatctatgggtttgatgcggag
ctcttagatatgatcccgcaacccgtacacgcaataatactcttataccccctgaaagaa
ggcatgagcaattcaaatactgaaacggatggaagtactgagcaaaatatagacaatatt
tggttcataaaacaggttgttccgaattcatgcggaacggtggccctttttcacctctac
ggaaatttaaagaataaatttgagctagacaaggactccctcttggctaattttttcgac
aaggtgaaggacatgacgcccgaaaaacgcggacaggaattcgaagtaaacaagagcatc
gaactgcttcatcacgaattttcaggaaaggcttccagcacgggggatgacatagacgtt
gatacccactttatcgtctttgtcgaaattgacgggaggctcgtcgaactggacggaagg
aaggaccatcccgttattcattgcacgacaactgctgccagtttcaaatacgacacggga
aatgtaatacaaaaaaaattcatagaaaaatgcaaagatgacaacagattttcagcctta
gcagttgtatcaagtgatgctgtgtag

DBGET integrated database retrieval system