KEGG   Plasmodium cynomolgi: PCYB_125460Help
Entry
PCYB_125460       CDS       T02490                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pcy  Plasmodium cynomolgi
Brite
Enzymes [BR:pcy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PCYB_125460
Peptidases [BR:pcy01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PCYB_125460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 228 aa AA seqDB search
MLRNNIWVPIESNPESLYLYSCKLGQSKLTFQDIYGFDAELLDMIPQPVHAIILLYPLKE
GMSNSNTETDGSTEQNIDNIWFIKQVVPNSCGTVALFHLYGNLKNKFELDKDSLLANFFD
KVKDMTPEKRGQEFEVNKSIELLHHEFSGKASSTGDDIDVDTHFIVFVEIDGRLVELDGR
KDHPVIHCTTTAASFKYDTGNVIQKKFIEKCKDDNRFSALAVVSSDAV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggaacaatatttgggttcccatcgagtccaacccggagtccctctacctttac
tcctgcaaacttggacagtcaaagttgacgtttcaggatatctatgggtttgatgcggag
ctcttagatatgatcccgcaacccgtacacgcaataatactcttataccccctgaaagaa
ggcatgagcaattcaaatactgaaacggatggaagtactgagcaaaatatagacaatatt
tggttcataaaacaggttgttccgaattcatgcggaacggtggccctttttcacctctac
ggaaatttaaagaataaatttgagctagacaaggactccctcttggctaattttttcgac
aaggtgaaggacatgacgcccgaaaaacgcggacaggaattcgaagtaaacaagagcatc
gaactgcttcatcacgaattttcaggaaaggcttccagcacgggggatgacatagacgtt
gatacccactttatcgtctttgtcgaaattgacgggaggctcgtcgaactggacggaagg
aaggaccatcccgttattcattgcacgacaactgctgccagtttcaaatacgacacggga
aatgtaatacaaaaaaaattcatagaaaaatgcaaagatgacaacagattttcagcctta
gcagttgtatcaagtgatgctgtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system