KEGG   Plasmodium cynomolgi: PCYB_125920Help
Entry
PCYB_125920       CDS       T02490                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase family protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
pcy  Plasmodium cynomolgi
Brite
Enzymes [BR:pcy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PCYB_125920
    1.3.1.94  polyprenol reductase
     PCYB_125920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 252 aa AA seqDB search
MMCDVSSLVHAMGEEGILKIICKAYYTVGCFVLLLSFHFKSINEWSLHGKNLYIKIEKGK
TDGEKTHSTFSKLRGKIDHMTISKKHFAHFYVIGLAVNSVLLICDLSQRAGSEQTAFHCI
SVTNVLLQVQLVRRLLEQLLVVRTTPKSVMHVFSYLLGVTFYLVTPYSLHNNDKREYTTV
GLLPVVVFLLGTLIQYDSHVRLAKLRPKGANKLDSPYKVPHGGLFHFVSCPHYFAEILIY
LSFLLLNWNFIR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgcgatgtctcatcattggtacacgccatgggcgaagaagggattctaaaaatt
atctgtaaagcttattacaccgttggatgttttgtcctccttctttctttccatttcaaa
tcaataaatgaatggtccctgcatgggaagaatttgtacatcaaaattgaaaaggggaaa
acggatggggaaaaaacgcactccacgttttcgaagctgagggggaagatagaccacatg
acaatttcgaaaaagcacttcgcgcatttttatgtgatcggcttggccgtcaattctgtg
ttgctcatctgtgacctcagtcaacgcgcagggagtgaacaaaccgccttccattgtatc
tccgtaacgaacgttttgcttcaagttcagttggtcaggagactactggagcagctgctc
gtcgtcaggacgacgccgaaatcggtcatgcacgttttttcgtacctcttgggcgtaacc
ttctaccttgtgacgccctattccctccacaacaatgacaaaagggagtatacaacagta
gggttactccctgttgttgtgttcctgttggggacattaattcagtatgattcccatgtc
cgcttggccaagcttcgtcccaaaggcgcaaacaagttagacagcccgtacaaagtacca
catgggggactcttccactttgtcagttgcccgcattatttcgccgaaattttaatctac
ctgtcctttttgctgctgaactggaatttcatcaggtaa

DBGET integrated database retrieval system