KEGG   Plasmodium cynomolgi: PCYB_132720Help
Entry
PCYB_132720       CDS       T02490                                 

Definition
mitogen-activated protein kinase 1
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pcy  Plasmodium cynomolgi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 687 aa AA seqDB search
MKKEGQQSKDEQVDESVLKKYDIVRKIGKGAYGIVYKARCKRNRKIVAVKKIFGAFQNAT
DAQRTFREIMFLYQLNGHDNIITLMDVIKAKNDNDIYLVFDYMETDLHEVIKADLLEEIH
KRYIIYQLLRALKYIHSGMLLHRDIKPSNILLNSECHIKVGDFGLARSISTELNENKIPV
LTDYVATRWYRAPEILLGSTNYTEGVDMWSLGCIMAELLLGRPLFRGNSTMNQLEKIIQV
IGKPTKKDIEDIKSPFTDTIISSFVDIKRKNFSEIFSKASVEALDLLKQLLQFNPTKRIT
AENALRHKYVEQFHSIIEEPVCSHIITIPVDDSTKYRVSFYRNIVYYDIMRRKKYHPGGR
SFEGGGKAGSEAAISEAAISEAALGEAATGEAATGEEDQQRETLPPPASTSKGKLQSSAA
PTREENATRITSHSGKCAPKIRSTQSIHNGRSGRSGRSGKNGDAGPTTETIHNNKPAKRQ
PKKIGKRECPEERHNGNASGHPNEKHYYEIAGEDRTGRGLDGYQRKEVRSAKVESRESRP
KASNGDAAGKLHKWSSERGKAVATAASVMWGRRNDDKGGYTGERRVDGKTASVIRGERMD
GRVDGRVDGRVDRRADKLVRSHLVSAADVEAVKADPPRMQPVAPQKRETVKWRKRGGDAG
ATAKRVDFCGAHCHDVTATAEKKNLKK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaaggacagcaaagcaaagacgagcaggtagacgaaagcgtactgaagaaa
tatgacatcgtgagaaaaataggaaaaggagcatacggaatagtatacaaggccaggtgt
aaaaggaacagaaaaattgtggcagtgaaaaaaatttttggtgcgttccaaaacgctaca
gatgcacaaaggacatttcgagagatcatgtttctgtatcaactgaatggacatgacaat
atcatcacactgatggatgtgatcaaggcaaagaatgataacgatatatatttggttttc
gattatatggagacagacttacacgaagtgataaaagctgatctgttggaagaaattcac
aaaaggtatatcatttatcagttattgagagcacttaagtatattcactcagggatgtta
ctccatcgtgatatcaaaccttcaaatatcctactcaattccgaatgtcatatcaaggtg
ggagacttcggattggcgagaagcatatctacagagctaaatgagaataaaattcccgta
ctaactgattatgtcgctacgagatggtatagagctccagaaattttgttgggaagtacc
aactacacggaaggagtagatatgtggtctcttggatgtatcatggcagagcttctacta
gggagacctctatttaggggtaactccacgatgaaccagttggagaaaattattcaagtt
attggaaaaccaacaaaaaaggatatagaagatattaagtctccctttacagatacgatt
atttcctcctttgttgatattaagagaaaaaatttttctgagattttttcgaaagcttct
gtggaggcacttgaccttctaaagcaacttttgcaattcaatccaactaagcggatcact
gcagagaatgcactgaggcacaagtacgtcgagcagttccattccattattgaggaacct
gtgtgtagccatatcattactatccccgtggatgacagcaccaagtaccgagtcagcttc
tacaggaatattgtttactacgacatcatgcggaggaagaagtaccaccctggtgggcgc
agctttgaggggggcggaaaagcgggcagtgaggcggccatcagtgaggcggccatcagt
gaggcggcccttggtgaggctgctaccggtgaggcggccaccggtgaggaggaccaacaa
agggagaccctccccccccctgcgagcaccagcaaggggaagctacagtcaagcgcagca
cccacgagggaggaaaatgcgacgaggatcacctcacacagcggaaaatgcgcccccaaa
attaggagcacgcaaagtatacacaacgggagaagtggcaggagtggtagaagtggcaaa
aatggagacgcaggccccaccacagagaccatccacaacaacaaaccggcgaagcgtcag
cctaagaagatcggaaaaagagagtgccccgaggagaggcacaacggaaatgcaagcggg
catccgaatgagaaacattattacgagatcgctggtgaggacagaacgggtaggggactc
gacggttatcaacgcaaagaggtgagaagcgcgaaagtggagagtagggaaagtaggccc
aaggcgtctaatggagacgcggcggggaagctccacaaatggtccagtgagaggggtaaa
gcggtcgccacagcggcttccgtcatgtggggcagaaggaacgatgataagggggggtat
acaggggagaggagggtcgacgggaaaactgcgagcgtaattaggggagagcgcatggac
gggcgcgtggacggtcgcgtggacggtcgcgttgaccggcgggcggacaaactggtgaga
agccacctggtgagcgcggccgacgtggaggcggtaaaggcggacccccccagaatgcag
cccgttgcgccccagaaaagggaaacggtcaagtggaggaagcgagggggtgacgcgggt
gcaacggcgaaacgtgttgacttttgcggggcccactgccacgacgtcacagcaactgca
gaaaagaagaatttaaaaaagtga

DBGET integrated database retrieval system