KEGG   Plasmodium cynomolgi: PCYB_135450Help
Entry
PCYB_135450       CDS       T02490                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pcy  Plasmodium cynomolgi
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PCYB_135450
Enzymes [BR:pcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PCYB_135450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 430 aa AA seqDB search
MESISRTYENIKNDKNNLSNVENAKNGNLKAAPNGTICCPEDLKMYSTIQLNQEIEISKN
PFPLQEVNKKNDIPLCAQEFSDLTDPLYIKKICLEKIPEWHHFTEDNLRVKQILSGLTNQ
LFEVGLKEETANNYHSIRTRVLFRIYGKHVDELYNTISEFEVYKTMSKYKIAPQLLNTFN
GGRIEEWLYGDPLRIDDLKNPTILIGIANVLGKFHTLSRKRHLPEHWDRTPCIFKMMEKW
KNQLFKYKNIEKYNCDIHKYIKESDKFIKFMSVYSKSDNLANSIVFCHNDLQENNIINTN
KCLRLIDFEYSGFNFLATDIANFFIETSIDYSKKYISYDNRKLFITAYLSNYLDKSHVAP
TPKLIDQILEAVEVQALGAHLLWGFWSIIRGYQTKSYNEFDFFLYAKERLKMYDDQKEYL
ISNNIIKDYD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtatcagcaggacatatgaaaatattaaaaatgataaaaataatttatcaaat
gttgaaaacgcgaaaaatggaaatttgaaagcggcccccaatggaaccatctgttgtcct
gaagacttaaaaatgtatagcactattcagctaaatcaggaaatagaaatatccaaaaat
ccatttcctttacaagaagttaataaaaaaaacgacataccattgtgtgcccaagaattt
tcggacctaacggatccgttatatattaaaaagatatgcctggagaaaataccagagtgg
caccattttaccgaagataatttaagggttaagcagatactaagtggactaaccaaccag
ttatttgaggtgggactaaaagaagaaacagcaaacaattatcattccataaggacacgt
gttttatttaggatttatggaaaacacgttgacgagttgtacaatacaatctccgaattt
gaagtgtacaaaactatgagcaaatataaaatagctccccagttgctaaacacatttaat
gggggacgcatagaggaatggctttatggggatcctctccgaattgatgatttaaaaaac
ccaaccatattaattggtattgcaaatgtgttgggtaaatttcataccctcagtcggaaa
cgccatttacctgaacactgggatagaacaccgtgtatctttaaaatgatggaaaaatgg
aaaaatcagctcttcaaatataaaaatatagaaaagtacaattgtgatattcataagtat
atcaaagaatctgataagtttattaaatttatgagtgtgtactccaagtcagacaattta
gcgaattccatcgttttttgccataatgacctacaagaaaacaacattattaacaccaat
aagtgtttacgcctaattgattttgaatactcaggctttaattttctcgcaacagatata
gccaactttttcatcgaaacatccatagattattctaaaaaatacatttcctatgataac
aggaaattgtttatcactgcatatttatcaaattatctggacaaatctcatgtcgcacca
acccccaaattaattgatcaaatattagaggcagtggaggttcaagcgttgggtgctcat
ttgttatggggattctggtccatcattagagggtatcaaaccaaaagttacaacgaattt
gatttttttctatacgcaaaagagaggcttaaaatgtatgatgaccagaaggagtattta
atttcaaacaacattattaaagattacgattaa

DBGET integrated database retrieval system