KEGG   Plasmodium cynomolgi: PCYB_141360Help
Entry
PCYB_141360       CDS       T02490                                 

Definition
DNA ligase 1 precursor
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
pcy  Plasmodium cynomolgi
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PCYB_141360
   03410 Base excision repair
    PCYB_141360
   03420 Nucleotide excision repair
    PCYB_141360
   03430 Mismatch repair
    PCYB_141360
Enzymes [BR:pcy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PCYB_141360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 920 aa AA seqDB search
MKLLVLLLIARMLMCKVNSCMRREYAYIIPFMQKNNFYRRKTNFSVKVFTNFRNKRLTNL
AFLIFFLCRKCLSFPKKTMDGQKEETDVKEESKMKEEEKETTKRKIASDGNTKTKKAKGK
SENDIKKGSLFNCTVREDDKVSDLTSPKFNPVHFDVSNLYLSQKDKEKHKFKDSLLFTFL
TNTFNQIEELKGSGTGSKKNVAIILSNVFRVLIYYSPNDLIPAVYITLNKVAPDYLNVEA
GVGEALILKTMSEAYSRTESSIKKDLQQIEDLGIIAESCSCKMRTIFPLPRLTIQSVFNE
LKSIPNLSGSNSQQKKREVIKKLLVSAKTSEAKYIVRFLQQRLRIGVNSATVLQALSYAF
ILTRPSIPEEIVQKGKLMNEQLLNAKGSGTGEDGTVSDSTTEDDKNKVKGEKGEVVKVEK
QNGESPSNIKKENEKENQSVHDQFDFDELVQSIKIRNEKISKPNLFYDIGKEGDTRLLPI
FKELKKSYCEMNNDSDIFECMEKSVKSALCELPNIEIIIQNLLNGDDMNTLSKKCTVKAG
LPVQPMLAKPTKGIQEVLDRFNNVTFTCEYKYDGERAQIHYIDKDNIKIFSRNLETMTEK
YPDVIQIVRDQIISGATECIIDSEVVAYDIENKKILPFQVLTTRKRKDVDIENIKVKICL
FPFDLICCNGVPVIKEPLEIRRKLLYSLLKCKDGVLCYATHSEMNNIEDIDIFLQDAIEN
NCEGLMVKTLLDNASYEPSRRSLNWLKVKKDYIEGLSDSVDLVPIAGYYGKGKRSGVYGA
FVLATYNSETENFQTVCKAGTGFSDEILGSLYETLSDKIIPNKKSYYEVSDKLNPDVWFD
AHYVWEVKAADLSLSPVHTAAIGVYSDDKGIGLRFPRFLRLREDKNAEQATTSQQIVDFY
EAQFTNNKNKNDFNEESESE
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgctcgtgctactcctcatagcgagaatgcttatgtgcaaagttaacagttgc
atgagaagagaatacgcttatataataccctttatgcaaaagaataacttctacaggcgc
aaaacaaattttagcgtgaaagttttcaccaactttagaaacaaaagattaaccaatttg
gcttttttgattttcttcctttgcaggaaatgcctgtccttcccgaagaaaacaatggat
gggcagaaggaagaaacggacgttaaggaggaatccaaaatgaaggaagaagagaaagaa
acaaccaagagaaaaatagcaagtgatggaaacacaaaaacgaaaaaggccaaagggaag
agtgaaaatgatataaaaaaagggtccctatttaactgcaccgttagggaagatgacaaa
gtgagcgatctgacatcacccaaatttaaccccgtacattttgatgtaagtaatttatac
ctttcgcaaaaggataaagaaaaacacaagtttaaagattctttattgttcacttttctg
acaaatacatttaaccaaatagaagaactaaagggaagtggaactggtagcaagaaaaat
gtagcaattatcctgtccaatgttttcagagttttaatatactacagtcccaacgattta
attccagctgtgtacataacgctaaacaaagtagcacctgattatttaaatgttgaagca
ggtgtaggagaagctctgattttgaaaacaatgtctgaggcttatagtagaactgaatca
agcataaaaaaggatttacaacaaattgaggatcttggcataatagcagaaagttgttct
tgcaagatgaggaccatttttcctttacctcgtttgactatccagtcagtatttaatgaa
ctgaagagcatacccaatttgagtggttctaactcgcagcagaaaaagagagaggtaatt
aagaagctgttggtgagtgcgaaaactagtgaagcgaaatatattgttcgttttttacaa
cagcgattgagaatcggagtgaacagcgctactgtgttgcaggccctgtcgtatgcattt
attttaacacgtccgtccattccggaagaaattgtacaaaaggggaaattgatgaacgag
caactgctaaacgcgaagggaagtggtactggggaggatggcactgttagcgacagcaca
acggaggatgacaagaataaggtgaagggggaaaagggggaggtggtcaaagtggagaag
caaaatggggagagtccttctaacataaagaaggaaaacgaaaaggaaaatcagagcgtg
cacgaccagttcgacttcgacgagctagtccagtccattaaaataagaaacgaaaaaata
agcaagccgaatttgttttacgacatagggaaggaaggagacactcgtttgttacccata
tttaaggagttaaaaaaaagctactgcgaaatgaataacgattcggacatttttgagtgc
atggaaaaatcagtgaagagcgccctctgtgagttaccaaatatcgaaattatcattcag
aatttgttaaatggagatgacatgaacacgttaagtaaaaaatgcacagtcaaagcgggg
ctacccgtgcaacctatgctagccaagccaacgaaaggaatacaagaagtacttgaccgg
ttcaacaatgtgacattcacgtgtgaatataaatatgacggagaaagggctcaaatacat
tacatagataaggacaatataaaaatttttagccgaaatttagaaaccatgacagagaaa
tatccagacgttattcaaatagtgcgggatcaaattatcagcggtgctacagagtgcatt
attgacagcgaagttgtggcttatgacatagagaataaaaagatattaccatttcaggta
ctgaccacgagaaagagaaaagatgtggacattgaaaatataaaggtgaaaatatgtctg
ttcccatttgacctcatttgttgtaatggtgtacccgttattaaagaaccactagaaatt
aggaggaagcttttgtattcattattgaaatgtaaggatggagtgctgtgttatgcaact
cactcagaaatgaacaatatagaagacattgatatatttttacaagatgctattgagaat
aattgtgaagggctaatggtgaaaacgcttctggataatgcgtcttacgaaccatcaaga
agatcattaaattggttgaaggtaaaaaaggattatatagaaggactatctgactcggta
gatttagtacccatagcgggttattatggaaaaggaaaaagaagtggagtgtatggtgca
ttcgttttagctacgtacaactcagaaactgaaaatttccaaactgtatgtaaagcaggc
accggttttagtgatgaaattcttggctcattatacgaaactttgagtgataaaattata
ccaaacaaaaaatcgtattacgaagtttcggataagttaaatcccgatgtgtggtttgat
gcgcactacgtatgggaggtaaaagcggccgacttgtctctctcacctgtgcataccgca
gccatcggggtttattcggatgacaagggtattggcttgcgttttccgaggtttctgagg
ctcagggaggataagaatgcggaacaggccaccacatcgcaacagattgttgacttctac
gaggcacagttcacgaacaacaaaaataaaaacgactttaatgaggaaagtgaaagtgaa
tga

DBGET integrated database retrieval system