KEGG   Phoenix dactylifera (date palm): 103699266Help
Entry
103699266         CDS       T03274                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00052  Galactose metabolism
pda00500  Starch and sucrose metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103699266
   00500 Starch and sucrose metabolism
    103699266
Enzymes [BR:pda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103699266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 103699266
NCBI-ProteinID: XP_008779528
UniProt: A0A2H3X7G7
Position
Un
AA seq 573 aa AA seqDB search
MGTPTRGVWTAWILLVVLFTARNGTVDASHVVYSHLQSLHVPVVNSLLKTGYHFQPPRNW
MNDPNGPMYYNGIYHLFYQYNPKGAVWGNIVWAHSISTDMINWIPLEPAIYPSKPFDING
TWSGSATILPGNKPAIMYTGIDGAGRQLQNVAFPKDLSDPYLREWTKPDYNPVIFPSGVN
ASAFRDPTTAWLGPDGHWRVTVGSKRSKRGMAYLYRSRDFVRWTKAKHPLHSSKDTGMWE
CPDFFPVAPAGKLGLDTSARGKGLKYVFKVSLDLTRFEYYTVGRYDLARDRYVPDNTSPD
NSTGLRFDYGNFYASKTFFDPAKQRRILWGWSNESDIAQNETTKGWAGIQAIPRVLWLDS
NQRQVVQWPIEELESLRTKQAYIHDKLVKSGHYFEVKGIQYSQADVEVTFDISSLEKAER
FNHTWTDPQKLCGRKDAEVRGGVGPFGLLVLASAKMEEKTAVFFRVFKAQNKHVVLMCHD
PKRSSLVPRVYEPTFAGFVDIDIANTKRISLRSLIDNSVVESFGAGGKTCITSRVYPTLA
VGPDAHLFVFNNGLEDIKVSELKAWEIRRPLMN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgggaactccaacaaggggagtttggacggcgtggatactactggtggttctcttcact
gcgaggaatggaacggtggatgcttctcatgtggtgtattctcacctccagtccctgcat
gtccccgttgtcaattctttgttgaagacaggctatcacttccagcctcccagaaactgg
atgaacgatccaaatggacccatgtactataatggaatataccacctattctaccaatac
aatcccaaaggcgcggtgtggggcaacatcgtgtgggcgcactcgatctcaacggacatg
atcaactggatcccgctcgaaccggcgatctacccgtccaaaccattcgacatcaacggg
acctggtcgggctcggcgaccattctccccggcaacaagccggccattatgtacacgggc
atcgacggagccggacgccagctccaaaacgtcgcattccccaaggacctatcggatccg
tacctccgggaatggaccaagcccgattacaaccccgtcatcttcccgtccggagtgaac
gcgagcgcgttccgcgaccccacgacggcctggctggggcccgacgggcactggagagtc
accgtcggaagcaagcgtagcaaacgggggatggcgtacttgtacagaagcagggacttc
gtgcgctggaccaaggccaagcacccgctgcactcgtccaaggacaccggcatgtgggag
tgcccggacttcttccccgtcgcgccggcgggcaagctcggcttggacacgtcagcccgc
gggaaggggttgaagtatgtgttcaaggtcagtttggacttgacgaggttcgagtattac
acggtgggaaggtatgaccttgctcgggataggtatgtgcccgacaatacgtcgcccgat
aatagcaccgggctcaggtttgattatggaaatttttatgcctccaagacgttcttcgat
ccggcaaaacagcggaggatcttgtgggggtggtcgaacgagtcggatatagctcagaat
gaaaccactaaaggctgggctgggattcaggcaattccgagggttctttggcttgacagc
aaccagcggcaagttgtgcaatggccgatcgaggagctcgaaagtcttagaacgaagcaa
gcttatatccatgacaagctggtgaaaagtgggcattattttgaagtaaaaggaatacaa
tattcacaggcagacgtggaggtaacttttgacatctcaagcctagaaaaagctgagaga
tttaatcatacttggactgatccccaaaaactctgcggccggaaggacgcagaagtcagg
ggtggagttgggcccttcggcctcctggttttggcttctgcaaagatggaggagaaaact
gctgtatttttcagggtgttcaaagctcagaataagcatgtggtcctaatgtgccatgat
cccaaaaggtcttctttagtgccgcgtgtctacgaaccaaccttcgccgggtttgtcgat
attgatatagccaatactaagagaatctctctaaggagcttgattgacaattctgtggtc
gagagctttggtgctggagggaagacatgcattacgtccagagtttatcctactttagca
gtaggaccggatgctcatctgtttgttttcaacaatgggttggaggatataaaagtttcg
gagctgaaagcatgggagatcaggaggcctctcatgaat

DBGET integrated database retrieval system