KEGG   Phoenix dactylifera (date palm): 103705165Help
Entry
103705165         CDS       T03274                                 

Definition
(RefSeq) beta-fructofuranosidase 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00052  Galactose metabolism
pda00500  Starch and sucrose metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103705165
   00500 Starch and sucrose metabolism
    103705165
Enzymes [BR:pda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103705165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 103705165
NCBI-ProteinID: XP_008787011
UniProt: A0A2H3XPX5
Position
Un
AA seq 658 aa AA seqDB search
MDVVDLESPIFIPYSYPPLPQVEDCDDSTIPNSSHKPPRGALRLVLLGITAITLLGLVSL
FYHGGGLRGELEFDPARETPVDRWTVSRGTAEGVSEKSNGPILGATPAYPWTNVMLAWQR
TAFHFQPQKNWMNDPNGPMLYKGWYHLFYQYNPESAVWGNITWGHAVSRDLVHWFYLPLA
MVPDHWYDAGGVWTGSATLLPDGRIAMVYTGSTADSVQVQNLAFPADQDDPLLIRWNKYE
SNPVLAPPPWIGPTDFRDPTTAWYVPTESAWRLAIGAKDADHKGIALVYQTKDFTSYELL
PGLLHGVNGTGMWECVDFYPVSTGSAVGLDTSTGPGPAVKHVLKASLDVNKRDYYAIGTY
DGDKGTWTPDEPEMDVGIGLRYDYGKFYASKSFYDPVKERRVLWGWTGETDSERTDLVKG
WASLQAIPRTIVYDDKTKRNLIQWPVDEVESLRLNSQEFSSIKLSTGSVVPLNVTEATQV
DIEAEFEIDSSALERAVEADVGYNCSTGGGAAGRGALGPFGLLVLADPDLKEQTAAYFYL
GRRTDGSLRTFFCQDELRSSLANDLVRRVYGSAVPVLDGESLTVRILVDHSIVESFAQGG
RTSITSRVYPTKAVYDAARVFLFNNATDASMIARSLKIWQMDSAFLHPYSAQTEELAI
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtagatctcgagtcccccatcttcatcccctattcctaccctccgttacca
caagtggaggactgcgatgactccaccattcccaactcttctcataaacctccgaggggg
gccttaaggctggtcttgcttggcatcacagccataacgctgctgggcctcgtctctctc
ttctaccatggcggcggactgagaggggaattggagttcgatccggcacgagagacaccc
gtggaccggtggaccgtgtcccggggcacggccgagggcgtgtcggagaagtccaacggg
ccgatcctcggcgctaccccggcctacccctggaccaacgtcatgctcgcctggcagcgc
acagccttccacttccagccccagaagaactggatgaatgaccctaatgggccgatgctt
tacaaggggtggtaccacctcttctatcagtacaacccggagtcggccgtgtgggggaac
atcacgtgggggcacgccgtatcacgtgacctcgtccactggttctaccttcccctcgcc
atggttcccgaccactggtacgacgccggcggcgtctggaccggctccgccaccctgctg
ccggacggccggatcgccatggtctacaccggttcgaccgccgattcggtccaggtccag
aacctcgccttcccggccgaccaggacgacccgctccttataagatggaacaagtacgag
tccaacccggttctcgcccccccgccgtggatcgggccgaccgacttccgcgatccgacc
acggcctggtacgtgccgacggagtcggcctggcggcttgccatcggagccaaggacgcg
gaccacaaagggatcgcgctggtgtaccagaccaaggactttacatcttacgagctgctg
ccgggcttgctccatggggtgaacgggacagggatgtgggagtgcgtggacttctacccg
gtgtcgaccgggtcggcggtggggctggacacgtcgaccgggccggggccggcggtgaaa
cacgtgctgaaggcgagtctagacgttaacaagcgcgactactacgcgatcgggacgtac
gacggcgacaaggggacttggacgccggacgagccggagatggacgtggggatcgggctg
aggtacgactacggcaagttctacgcgtcgaagtcgttctacgacccggtgaaggagagg
cgagtgctgtggggttggaccggggagaccgatagcgaacggaccgatctcgtgaagggc
tgggcctccctgcaggccattccaaggacgatcgtatatgatgacaagacgaagaggaac
ctaatacagtggccagttgacgaggtggagagcctaagattgaacagccaagaattcagc
agcatcaaacttagcacaggatcggtggtgccattgaacgtcaccgaagccacgcaggtg
gacatcgaggccgagttcgagatagactcatcggccttggaacgggctgtcgaggccgac
gtcgggtacaactgcagcaccggcggcggtgctgccgggcgtggtgcattgggacccttc
ggattgcttgtgttggctgatccggacctgaaggagcagaccgcagcgtatttttacctc
ggcaggagaaccgatggcagccttaggacattcttctgtcaggatgagctgaggtcatcg
ttggcaaatgaccttgtgaggagggtttacggcagtgcggttcccgtgctcgatggtgaa
agcttgacagtgaggattctggtggatcactccatagtagagagctttgctcaaggtggg
aggacaagcatcacatcacgcgtctacccaacgaaagcagtttatgatgcggcgagagta
tttcttttcaacaacgcaaccgacgcttccatgatcgccagatcactcaagatatggcag
atggactctgcattccttcatccgtactcagcccagactgaagagctcgcgatttaa

DBGET integrated database retrieval system