KEGG   Phoenix dactylifera (date palm): 103712171Help
Entry
103712171         CDS       T03274                                 

Definition
(RefSeq) beta-fructofuranosidase 1
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103712171
   00500 Starch and sucrose metabolism
    103712171
Enzymes [BR:pda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103712171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 647 aa AA seqDB search
MDVPDLESPIFIPSSYSPSPQVDDHDDSSIPASSPRPSRRSLMLVLFAISAVSLLGLVSA
PFYDGGELESDRAAETPMERWTVSRGPAMGVSEKSNGPNLGATPVYPWTNAMLVWQRTAY
HFQPQKNWMNDPDGPMYYKGWYHLFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPLALVP
DHWYDANGVWTGSATLLPDGRIAVVYTGSTTESVQVQNLAFPADPADPLLLRWNKSESNP
VIRPPPWVGLTDFRDPTTAWHVPTESAWRIAIGSKDADHNGIALVYQTKDFATYELLPRL
LHSVNRTGMWECLDFYPVSTVSAAGLDTSTGGPGVKHVLKASLDDNKHDYYAIGTYDGEE
GTWTPDDQEMDVGIGLRYDYGKYYASKTFYDPVKERRVLWGWIGETDSERTDLLKGWASV
QTIPRTVIYDNKTGRNLLQWPVDEAESLRLSSKEYSNIKLSNGSVVPLDISEATQLDIEA
EFEIDALSLKQTIEADVGYNCSTSGGAAGRGALGPFGLLVLADQDLSEQTAVYFYLGRGT
NGGLSTFFCQDELRSSMANDLVRRVYGSSVPVLDGERLTVRILVDHSIVESFAQGGRTCI
TSRVYPTEAIYGAARVFLFNNATGAPVTAKSLKIWQMSSAFIHPYSA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcccggatctggagtcccccatcttcatcccctcctcctactctccttcccca
caagtcgacgaccacgatgattcctccattcctgcctcctctcctagaccttcgaggagg
tccttaatgttagtcctgttcgccatctcagccgtatctctgctgggcctcgtctcagct
ccgttttacgatggaggagaattggagtccgaccgggcagcggagactccaatggaacga
tggaccgtgtcccgcggcccggccatgggcgtgtcggagaagtccaacggaccgaacctc
ggcgccaccccggtctacccctggaccaacgccatgctcgtctggcagcgcacggcctac
cacttccagccccagaagaactggatgaatgaccctgacgggccgatgtattacaagggg
tggtatcacctgttctaccagtacaacccggactcggcggtgtgggggaacatcacgtgg
gggcacgctgtgtcacgtgacctcatccactggctctaccttcccctcgccttggtcccc
gaccactggtacgacgccaacggcgtctggaccggctccgccacgctcctgccggacggc
cggatcgccgtggtctacaccggatcgaccaccgagtcagtccaggtccagaacctcgct
ttcccggccgacccggccgacccgctccttctcaggtggaacaagtccgagtcgaacccg
gtaatccgtcccccgccctgggtcgggctgaccgacttccgcgacccaaccacggcctgg
cacgttccgaccgagtcggcctggcggatcgccatcggctcgaaggacgcggaccacaac
ggaatcgcgctggtgtaccagaccaaggacttcgcaacctacgagctgctcccgaggctg
ctccactcggtgaaccggaccgggatgtgggagtgcttggacttctacccggtgtcgacc
gtgtcggcggcgggcctggacacgtcgaccggggggccgggggtgaagcacgtgctgaag
gcgagcctggacgacaacaagcacgactattacgcgatcggcacgtacgacggggaagag
gggacgtggacgccggacgaccaggagatggacgtggggatcgggctgaggtacgactac
ggcaagtactacgcgtcgaagacgttctacgacccggtgaaggagcggcgcgtgctgtgg
ggttggatcggggagaccgacagcgagcggacggacctcctcaagggctgggcctccgtg
cagaccataccaaggacagttatctatgataataagacgggaagaaaccttctccagtgg
ccagtcgatgaggcggagagcctaaggctgagcagcaaagagtacagcaacatcaaacta
agcaacggatcagtggtgccattggacatcagcgaagccacacagttggacattgaggcc
gagttcgagatagatgcgttgtccttgaaacagaccatcgaggccgacgtggggtacaac
tgcagcacaagcggtggtgctgctgggcgtggtgcattggggccttttggattgctcgtg
ttggccgatcaggacctaagcgagcagactgcagtgtatttttaccttgggaggggaaca
aatggcggccttagtactttcttctgccaggatgagttgaggtcatcgatggcaaatgac
cttgtcaggagggtttacggtagctcggttccggtgctcgatggtgaaaggttgacagtg
aggattctggtggatcactccatagtagagagctttgctcaagggggaaggacatgcatc
acatcgcgcgtgtatccaactgaagcaatctatggcgcggcacgagtcttcctcttcaac
aatgcaaccggcgctcccgtgaccgccaaatcgctcaagatatggcagatgagctcggca
ttcattcatccgtactcggcctag

DBGET integrated database retrieval system