GenomeNet

Database: PDB
Entry: 3JBR
LinkDB: 3JBR
Original site: 3JBR 
HEADER    MEMBRANE PROTEIN                        29-SEP-15   3JBR              
TITLE     CRYO-EM STRUCTURE OF THE RABBIT VOLTAGE-GATED CALCIUM CHANNEL CAV1.1  
TITLE    2 COMPLEX AT 4.2 ANGSTROM                                              
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: VOLTAGE-DEPENDENT L-TYPE CALCIUM CHANNEL SUBUNIT ALPHA-1S; 
COMPND   3 CHAIN: A;                                                            
COMPND   4 SYNONYM: CALCIUM CHANNEL, L TYPE, ALPHA-1 POLYPEPTIDE, ISOFORM 3,    
COMPND   5 SKELETAL MUSCLE, VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT ALPHA CAV1.1; 
COMPND   6 MOL_ID: 2;                                                           
COMPND   7 MOLECULE: VOLTAGE-DEPENDENT L-TYPE CALCIUM CHANNEL SUBUNIT BETA-2;   
COMPND   8 CHAIN: B;                                                            
COMPND   9 SYNONYM: CAB2, CALCIUM CHANNEL VOLTAGE-DEPENDENT SUBUNIT BETA 2';    
COMPND  10 ENGINEERED: YES;                                                     
COMPND  11 OTHER_DETAILS: CHAIN B IS FOR A SUBUNIT THAT IS DOCKED BY A HOMOLOG  
COMPND  12 CRYSTAL STRUCTURE (PDB CODE: 1T0J);                                  
COMPND  13 MOL_ID: 3;                                                           
COMPND  14 MOLECULE: VOLTAGE-DEPENDENT CALCIUM CHANNEL GAMMA-1 SUBUNIT;         
COMPND  15 CHAIN: E;                                                            
COMPND  16 SYNONYM: DIHYDROPYRIDINE-SENSITIVE L-TYPE, SKELETAL MUSCLE CALCIUM   
COMPND  17 CHANNEL SUBUNIT GAMMA;                                               
COMPND  18 MOL_ID: 4;                                                           
COMPND  19 MOLECULE: VOLTAGE-DEPENDENT CALCIUM CHANNEL SUBUNIT ALPHA-2/DELTA-1; 
COMPND  20 CHAIN: F;                                                            
COMPND  21 SYNONYM: VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT ALPHA-2/DELTA-1,      
COMPND  22 VOLTAGE-DEPENDENT CALCIUM CHANNEL SUBUNIT ALPHA-2-1, VOLTAGE-        
COMPND  23 DEPENDENT CALCIUM CHANNEL SUBUNIT DELTA-1                            
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: ORYCTOLAGUS CUNICULUS;                          
SOURCE   3 ORGANISM_COMMON: EUROPEAN RABBIT,JAPANESE WHITE RABBIT,DOMESTIC      
SOURCE   4 RABBIT,RABBITS;                                                      
SOURCE   5 ORGANISM_TAXID: 9986;                                                
SOURCE   6 MOL_ID: 2;                                                           
SOURCE   7 ORGANISM_SCIENTIFIC: RATTUS NORVEGICUS;                              
SOURCE   8 ORGANISM_COMMON: RAT;                                                
SOURCE   9 ORGANISM_TAXID: 10116;                                               
SOURCE  10 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE  11 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE  12 MOL_ID: 3;                                                           
SOURCE  13 ORGANISM_SCIENTIFIC: ORYCTOLAGUS CUNICULUS;                          
SOURCE  14 ORGANISM_COMMON: EUROPEAN RABBIT,JAPANESE WHITE RABBIT,DOMESTIC      
SOURCE  15 RABBIT,RABBITS;                                                      
SOURCE  16 ORGANISM_TAXID: 9986;                                                
SOURCE  17 MOL_ID: 4;                                                           
SOURCE  18 ORGANISM_SCIENTIFIC: ORYCTOLAGUS CUNICULUS;                          
SOURCE  19 ORGANISM_COMMON: EUROPEAN RABBIT,JAPANESE WHITE RABBIT,DOMESTIC      
SOURCE  20 RABBIT,RABBITS;                                                      
SOURCE  21 ORGANISM_TAXID: 9986                                                 
KEYWDS    MEMBRANE PROTEIN, VOLTAGE-GATED CALCIUM CHANNEL                       
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    J.P.WU,Z.YAN,N.YAN                                                    
REVDAT   1   30-DEC-15 3JBR    0                                                
JRNL        AUTH   J.P.WU,Z.YAN,Z.Q.LI,C.G.YAN,S.LU,M.Q.DONG,N.YAN              
JRNL        TITL   STRUCTURE OF THE VOLTAGE-GATED CALCIUM CHANNEL CAV1.1        
JRNL        TITL 2 COMPLEX                                                      
JRNL        REF    SCIENCE                       V. 350 D2395 2015              
JRNL        REFN                   ISSN 0036-8075                               
JRNL        PMID   26680202                                                     
JRNL        DOI    10.1126/SCIENCE.AAD2395                                      
REMARK   2                                                                      
REMARK   2 RESOLUTION.    4.20 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : CHIMERA, SITUS                            
REMARK   3   RECONSTRUCTION SCHEMA  : NULL                                      
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : 1T0J                                
REMARK   3   REFINEMENT SPACE             : REAL                                
REMARK   3   REFINEMENT PROTOCOL          : RIGID BODY                          
REMARK   3   REFINEMENT TARGET            : NULL                                
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 4.200                          
REMARK   3   NUMBER OF PARTICLES               : NULL                           
REMARK   3   CTF CORRECTION METHOD             : EACH MICROGRAPH                
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: (SINGLE PARTICLE DETAILS: THE PARTICLES WERE          
REMARK   3  SELECTED USING RELION.) (SINGLE PARTICLE--APPLIED SYMMETRY: C1)     
REMARK   4                                                                      
REMARK   4 3JBR COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBJ ON 20-OCT-15.                  
REMARK 100 THE RCSB ID CODE IS RCSB160501.                                      
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : VITREOUS ICE (CRYO EM)            
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : ASYMMETRIC                        
REMARK 245   NAME OF SAMPLE                 : A MEMBRANE PROTEIN CRYO-SAMPLE    
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : 0.10                              
REMARK 245   SAMPLE SUPPORT DETAILS         : CARBON COATED GRID                
REMARK 245   SAMPLE VITRIFICATION DETAILS   : NULL                              
REMARK 245   SAMPLE BUFFER                  : 20MM MOPS, 200MM NACL, 0.5MM      
REMARK 245                                    CACL2,0.1% DIGITONIN              
REMARK 245   PH                             : 7.40                              
REMARK 245   SAMPLE DETAILS                 : THE SAMPLE WAS MONODISPERSE       
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : 02-FEB-15                      
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : NULL                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI TITAN KRIOS                
REMARK 245   DETECTOR TYPE                     : GATAN K2 (4K X 4K)             
REMARK 245   MINIMUM DEFOCUS (NM)              : 2.00                           
REMARK 245   MAXIMUM DEFOCUS (NM)              : 3.30                           
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : 0.00                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : 0.00                           
REMARK 245   NOMINAL CS                        : 2.70                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 50.00                          
REMARK 245   ILLUMINATION MODE                 : SPOT SCAN                      
REMARK 245   NOMINAL MAGNIFICATION             : NULL                           
REMARK 245   CALIBRATED MAGNIFICATION          : NULL                           
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 1                              
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: TETRAMERIC                        
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, E, F                            
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     MET A     1                                                      
REMARK 465     GLU A     2                                                      
REMARK 465     PRO A     3                                                      
REMARK 465     SER A     4                                                      
REMARK 465     SER A     5                                                      
REMARK 465     PRO A     6                                                      
REMARK 465     GLN A     7                                                      
REMARK 465     ASP A     8                                                      
REMARK 465     GLU A     9                                                      
REMARK 465     GLY A    10                                                      
REMARK 465     LEU A    11                                                      
REMARK 465     ARG A    12                                                      
REMARK 465     LYS A    13                                                      
REMARK 465     LYS A    14                                                      
REMARK 465     GLN A    15                                                      
REMARK 465     PRO A    16                                                      
REMARK 465     LYS A    17                                                      
REMARK 465     LYS A    18                                                      
REMARK 465     PRO A    19                                                      
REMARK 465     LEU A    20                                                      
REMARK 465     PRO A    21                                                      
REMARK 465     GLU A    22                                                      
REMARK 465     VAL A    23                                                      
REMARK 465     LEU A    24                                                      
REMARK 465     PRO A    25                                                      
REMARK 465     ARG A    26                                                      
REMARK 465     PRO A    27                                                      
REMARK 465     PRO A    28                                                      
REMARK 465     ARG A    29                                                      
REMARK 465     ALA A    30                                                      
REMARK 465     LEU A    31                                                      
REMARK 465     GLU A   140                                                      
REMARK 465     GLN A   141                                                      
REMARK 465     VAL A   142                                                      
REMARK 465     ASN A   143                                                      
REMARK 465     VAL A   144                                                      
REMARK 465     ILE A   145                                                      
REMARK 465     GLN A   146                                                      
REMARK 465     SER A   147                                                      
REMARK 465     ASN A   148                                                      
REMARK 465     THR A   149                                                      
REMARK 465     ALA A   150                                                      
REMARK 465     PRO A   151                                                      
REMARK 465     MET A   152                                                      
REMARK 465     SER A   153                                                      
REMARK 465     SER A   154                                                      
REMARK 465     LYS A   155                                                      
REMARK 465     GLY A   156                                                      
REMARK 465     ALA A   157                                                      
REMARK 465     GLY A   158                                                      
REMARK 465     LEU A   159                                                      
REMARK 465     ASP A   160                                                      
REMARK 465     LYS A   345                                                      
REMARK 465     SER A   346                                                      
REMARK 465     ARG A   347                                                      
REMARK 465     GLY A   348                                                      
REMARK 465     THR A   349                                                      
REMARK 465     PHE A   350                                                      
REMARK 465     GLN A   351                                                      
REMARK 465     LYS A   352                                                      
REMARK 465     LEU A   353                                                      
REMARK 465     ARG A   354                                                      
REMARK 465     GLU A   355                                                      
REMARK 465     LYS A   356                                                      
REMARK 465     GLY A   373                                                      
REMARK 465     GLU A   374                                                      
REMARK 465     VAL A   375                                                      
REMARK 465     MET A   376                                                      
REMARK 465     ASP A   377                                                      
REMARK 465     VAL A   378                                                      
REMARK 465     GLU A   379                                                      
REMARK 465     ASP A   380                                                      
REMARK 465     LEU A   381                                                      
REMARK 465     ARG A   382                                                      
REMARK 465     GLU A   383                                                      
REMARK 465     GLY A   384                                                      
REMARK 465     LYS A   385                                                      
REMARK 465     LEU A   386                                                      
REMARK 465     SER A   387                                                      
REMARK 465     LEU A   388                                                      
REMARK 465     GLU A   389                                                      
REMARK 465     GLU A   390                                                      
REMARK 465     GLY A   391                                                      
REMARK 465     GLY A   392                                                      
REMARK 465     SER A   393                                                      
REMARK 465     ASP A   394                                                      
REMARK 465     THR A   395                                                      
REMARK 465     GLU A   396                                                      
REMARK 465     SER A   397                                                      
REMARK 465     LEU A   398                                                      
REMARK 465     TYR A   399                                                      
REMARK 465     GLU A   400                                                      
REMARK 465     ILE A   401                                                      
REMARK 465     GLU A   402                                                      
REMARK 465     GLY A   403                                                      
REMARK 465     LEU A   404                                                      
REMARK 465     ASN A   405                                                      
REMARK 465     LYS A   406                                                      
REMARK 465     ILE A   407                                                      
REMARK 465     ILE A   408                                                      
REMARK 465     GLN A   409                                                      
REMARK 465     PHE A   410                                                      
REMARK 465     ILE A   411                                                      
REMARK 465     ARG A   412                                                      
REMARK 465     HIS A   413                                                      
REMARK 465     TRP A   414                                                      
REMARK 465     ARG A   415                                                      
REMARK 465     GLN A   416                                                      
REMARK 465     TRP A   417                                                      
REMARK 465     ASN A   418                                                      
REMARK 465     ARG A   419                                                      
REMARK 465     VAL A   420                                                      
REMARK 465     PHE A   421                                                      
REMARK 465     ARG A   422                                                      
REMARK 465     TRP A   423                                                      
REMARK 465     LYS A   424                                                      
REMARK 465     LEU A   670                                                      
REMARK 465     THR A   671                                                      
REMARK 465     SER A   672                                                      
REMARK 465     ALA A   673                                                      
REMARK 465     GLN A   674                                                      
REMARK 465     LYS A   675                                                      
REMARK 465     ALA A   676                                                      
REMARK 465     LYS A   677                                                      
REMARK 465     ALA A   678                                                      
REMARK 465     GLU A   679                                                      
REMARK 465     GLU A   680                                                      
REMARK 465     ARG A   681                                                      
REMARK 465     LYS A   682                                                      
REMARK 465     ARG A   683                                                      
REMARK 465     ARG A   684                                                      
REMARK 465     LYS A   685                                                      
REMARK 465     MET A   686                                                      
REMARK 465     SER A   687                                                      
REMARK 465     ARG A   688                                                      
REMARK 465     GLY A   689                                                      
REMARK 465     LEU A   690                                                      
REMARK 465     PRO A   691                                                      
REMARK 465     ASP A   692                                                      
REMARK 465     LYS A   693                                                      
REMARK 465     THR A   694                                                      
REMARK 465     GLU A   695                                                      
REMARK 465     GLU A   696                                                      
REMARK 465     GLU A   697                                                      
REMARK 465     LYS A   698                                                      
REMARK 465     SER A   699                                                      
REMARK 465     VAL A   700                                                      
REMARK 465     MET A   701                                                      
REMARK 465     ALA A   702                                                      
REMARK 465     LYS A   703                                                      
REMARK 465     LYS A   704                                                      
REMARK 465     LEU A   705                                                      
REMARK 465     GLU A   706                                                      
REMARK 465     GLN A   707                                                      
REMARK 465     LYS A   708                                                      
REMARK 465     PRO A   709                                                      
REMARK 465     LYS A   710                                                      
REMARK 465     GLY A   711                                                      
REMARK 465     GLU A   712                                                      
REMARK 465     GLY A   713                                                      
REMARK 465     ILE A   714                                                      
REMARK 465     PRO A   715                                                      
REMARK 465     THR A   716                                                      
REMARK 465     THR A   717                                                      
REMARK 465     ALA A   718                                                      
REMARK 465     LYS A   719                                                      
REMARK 465     LEU A   720                                                      
REMARK 465     LYS A   721                                                      
REMARK 465     VAL A   722                                                      
REMARK 465     ASP A   723                                                      
REMARK 465     GLU A   724                                                      
REMARK 465     PHE A   725                                                      
REMARK 465     GLU A   726                                                      
REMARK 465     SER A   727                                                      
REMARK 465     ASN A   728                                                      
REMARK 465     VAL A   729                                                      
REMARK 465     ASN A   730                                                      
REMARK 465     GLU A   731                                                      
REMARK 465     VAL A   732                                                      
REMARK 465     LYS A   733                                                      
REMARK 465     ASP A   734                                                      
REMARK 465     PRO A   735                                                      
REMARK 465     TYR A   736                                                      
REMARK 465     PRO A   737                                                      
REMARK 465     SER A   738                                                      
REMARK 465     ALA A   739                                                      
REMARK 465     ASP A   740                                                      
REMARK 465     PHE A   741                                                      
REMARK 465     PRO A   742                                                      
REMARK 465     GLY A   743                                                      
REMARK 465     ASP A   744                                                      
REMARK 465     ASP A   745                                                      
REMARK 465     GLU A   746                                                      
REMARK 465     GLU A   747                                                      
REMARK 465     ASP A   748                                                      
REMARK 465     GLU A   749                                                      
REMARK 465     PRO A   750                                                      
REMARK 465     GLU A   751                                                      
REMARK 465     ILE A   752                                                      
REMARK 465     PRO A   753                                                      
REMARK 465     VAL A   754                                                      
REMARK 465     SER A   755                                                      
REMARK 465     PRO A   756                                                      
REMARK 465     ARG A   757                                                      
REMARK 465     PRO A   758                                                      
REMARK 465     ARG A   759                                                      
REMARK 465     PRO A   760                                                      
REMARK 465     LEU A   761                                                      
REMARK 465     ALA A   762                                                      
REMARK 465     GLU A   763                                                      
REMARK 465     LEU A   764                                                      
REMARK 465     GLN A   765                                                      
REMARK 465     LEU A   766                                                      
REMARK 465     LYS A   767                                                      
REMARK 465     GLU A   768                                                      
REMARK 465     LYS A   769                                                      
REMARK 465     ALA A   770                                                      
REMARK 465     VAL A   771                                                      
REMARK 465     PRO A   772                                                      
REMARK 465     ILE A   773                                                      
REMARK 465     PRO A   774                                                      
REMARK 465     GLU A   775                                                      
REMARK 465     ALA A   776                                                      
REMARK 465     SER A   777                                                      
REMARK 465     SER A   778                                                      
REMARK 465     PHE A   779                                                      
REMARK 465     PHE A   780                                                      
REMARK 465     ILE A   781                                                      
REMARK 465     PHE A   782                                                      
REMARK 465     SER A   783                                                      
REMARK 465     PRO A   784                                                      
REMARK 465     THR A   785                                                      
REMARK 465     ASN A   786                                                      
REMARK 465     LYS A   787                                                      
REMARK 465     VAL A   788                                                      
REMARK 465     ARG A   789                                                      
REMARK 465     VAL A   790                                                      
REMARK 465     LEU A   791                                                      
REMARK 465     CYS A   792                                                      
REMARK 465     HIS A   793                                                      
REMARK 465     ARG A   794                                                      
REMARK 465     ILE A   795                                                      
REMARK 465     VAL A   796                                                      
REMARK 465     ASN A   797                                                      
REMARK 465     LYS A  1077                                                      
REMARK 465     ASN A  1078                                                      
REMARK 465     CYS A  1079                                                      
REMARK 465     GLU A  1080                                                      
REMARK 465     LEU A  1081                                                      
REMARK 465     ASP A  1082                                                      
REMARK 465     LYS A  1083                                                      
REMARK 465     ASN A  1084                                                      
REMARK 465     GLN A  1085                                                      
REMARK 465     ARG A  1086                                                      
REMARK 465     GLN A  1087                                                      
REMARK 465     CYS A  1088                                                      
REMARK 465     VAL A  1089                                                      
REMARK 465     GLN A  1090                                                      
REMARK 465     TYR A  1091                                                      
REMARK 465     ALA A  1092                                                      
REMARK 465     LEU A  1093                                                      
REMARK 465     LYS A  1094                                                      
REMARK 465     ALA A  1095                                                      
REMARK 465     ARG A  1096                                                      
REMARK 465     PRO A  1097                                                      
REMARK 465     LEU A  1098                                                      
REMARK 465     ARG A  1099                                                      
REMARK 465     CYS A  1100                                                      
REMARK 465     TYR A  1101                                                      
REMARK 465     ILE A  1102                                                      
REMARK 465     PHE A  1205                                                      
REMARK 465     LEU A  1206                                                      
REMARK 465     ALA A  1207                                                      
REMARK 465     SER A  1208                                                      
REMARK 465     SER A  1209                                                      
REMARK 465     GLY A  1210                                                      
REMARK 465     GLY A  1211                                                      
REMARK 465     LEU A  1212                                                      
REMARK 465     TYR A  1213                                                      
REMARK 465     CYS A  1214                                                      
REMARK 465     LEU A  1215                                                      
REMARK 465     GLY A  1216                                                      
REMARK 465     GLY A  1217                                                      
REMARK 465     GLY A  1218                                                      
REMARK 465     CYS A  1219                                                      
REMARK 465     GLY A  1220                                                      
REMARK 465     ASN A  1221                                                      
REMARK 465     VAL A  1222                                                      
REMARK 465     ASP A  1223                                                      
REMARK 465     PRO A  1224                                                      
REMARK 465     ASP A  1225                                                      
REMARK 465     GLU A  1226                                                      
REMARK 465     SER A  1227                                                      
REMARK 465     ALA A  1228                                                      
REMARK 465     GLN A  1299                                                      
REMARK 465     ILE A  1300                                                      
REMARK 465     GLY A  1521                                                      
REMARK 465     LYS A  1522                                                      
REMARK 465     PHE A  1523                                                      
REMARK 465     TYR A  1524                                                      
REMARK 465     ALA A  1525                                                      
REMARK 465     THR A  1526                                                      
REMARK 465     PHE A  1527                                                      
REMARK 465     LEU A  1528                                                      
REMARK 465     ILE A  1529                                                      
REMARK 465     GLN A  1530                                                      
REMARK 465     GLU A  1531                                                      
REMARK 465     HIS A  1532                                                      
REMARK 465     PHE A  1533                                                      
REMARK 465     ARG A  1534                                                      
REMARK 465     LYS A  1535                                                      
REMARK 465     PHE A  1536                                                      
REMARK 465     MET A  1537                                                      
REMARK 465     LYS A  1538                                                      
REMARK 465     ARG A  1539                                                      
REMARK 465     GLN A  1540                                                      
REMARK 465     GLU A  1541                                                      
REMARK 465     GLU A  1542                                                      
REMARK 465     TYR A  1543                                                      
REMARK 465     TYR A  1544                                                      
REMARK 465     GLY A  1545                                                      
REMARK 465     TYR A  1546                                                      
REMARK 465     ARG A  1547                                                      
REMARK 465     PRO A  1548                                                      
REMARK 465     LYS A  1549                                                      
REMARK 465     LYS A  1550                                                      
REMARK 465     ASP A  1551                                                      
REMARK 465     THR A  1552                                                      
REMARK 465     VAL A  1553                                                      
REMARK 465     GLN A  1554                                                      
REMARK 465     ILE A  1555                                                      
REMARK 465     GLN A  1556                                                      
REMARK 465     ALA A  1557                                                      
REMARK 465     GLY A  1558                                                      
REMARK 465     LEU A  1559                                                      
REMARK 465     ARG A  1560                                                      
REMARK 465     THR A  1561                                                      
REMARK 465     ILE A  1562                                                      
REMARK 465     GLU A  1563                                                      
REMARK 465     GLU A  1564                                                      
REMARK 465     GLU A  1565                                                      
REMARK 465     ALA A  1566                                                      
REMARK 465     ALA A  1567                                                      
REMARK 465     PRO A  1568                                                      
REMARK 465     GLU A  1569                                                      
REMARK 465     ILE A  1570                                                      
REMARK 465     ARG A  1571                                                      
REMARK 465     ARG A  1572                                                      
REMARK 465     THR A  1573                                                      
REMARK 465     ILE A  1574                                                      
REMARK 465     SER A  1575                                                      
REMARK 465     GLY A  1576                                                      
REMARK 465     ASP A  1577                                                      
REMARK 465     LEU A  1578                                                      
REMARK 465     THR A  1579                                                      
REMARK 465     ALA A  1580                                                      
REMARK 465     GLU A  1581                                                      
REMARK 465     GLU A  1582                                                      
REMARK 465     GLU A  1583                                                      
REMARK 465     LEU A  1584                                                      
REMARK 465     GLU A  1585                                                      
REMARK 465     ARG A  1586                                                      
REMARK 465     ALA A  1587                                                      
REMARK 465     MET A  1588                                                      
REMARK 465     VAL A  1589                                                      
REMARK 465     GLU A  1590                                                      
REMARK 465     ALA A  1591                                                      
REMARK 465     ALA A  1592                                                      
REMARK 465     MET A  1593                                                      
REMARK 465     GLU A  1594                                                      
REMARK 465     GLU A  1595                                                      
REMARK 465     ARG A  1596                                                      
REMARK 465     ILE A  1597                                                      
REMARK 465     PHE A  1598                                                      
REMARK 465     ARG A  1599                                                      
REMARK 465     ARG A  1600                                                      
REMARK 465     THR A  1601                                                      
REMARK 465     GLY A  1602                                                      
REMARK 465     GLY A  1603                                                      
REMARK 465     LEU A  1604                                                      
REMARK 465     PHE A  1605                                                      
REMARK 465     GLY A  1606                                                      
REMARK 465     GLN A  1607                                                      
REMARK 465     VAL A  1608                                                      
REMARK 465     ASP A  1609                                                      
REMARK 465     THR A  1610                                                      
REMARK 465     PHE A  1611                                                      
REMARK 465     LEU A  1612                                                      
REMARK 465     GLU A  1613                                                      
REMARK 465     ARG A  1614                                                      
REMARK 465     THR A  1615                                                      
REMARK 465     ASN A  1616                                                      
REMARK 465     SER A  1617                                                      
REMARK 465     LEU A  1618                                                      
REMARK 465     PRO A  1619                                                      
REMARK 465     PRO A  1620                                                      
REMARK 465     VAL A  1621                                                      
REMARK 465     MET A  1622                                                      
REMARK 465     ALA A  1623                                                      
REMARK 465     ASN A  1624                                                      
REMARK 465     GLN A  1625                                                      
REMARK 465     ARG A  1626                                                      
REMARK 465     PRO A  1627                                                      
REMARK 465     LEU A  1628                                                      
REMARK 465     GLN A  1629                                                      
REMARK 465     PHE A  1630                                                      
REMARK 465     ALA A  1631                                                      
REMARK 465     GLU A  1632                                                      
REMARK 465     ILE A  1633                                                      
REMARK 465     GLU A  1634                                                      
REMARK 465     MET A  1635                                                      
REMARK 465     GLU A  1636                                                      
REMARK 465     GLU A  1637                                                      
REMARK 465     LEU A  1638                                                      
REMARK 465     GLU A  1639                                                      
REMARK 465     SER A  1640                                                      
REMARK 465     PRO A  1641                                                      
REMARK 465     VAL A  1642                                                      
REMARK 465     PHE A  1643                                                      
REMARK 465     LEU A  1644                                                      
REMARK 465     GLU A  1645                                                      
REMARK 465     ASP A  1646                                                      
REMARK 465     PHE A  1647                                                      
REMARK 465     PRO A  1648                                                      
REMARK 465     GLN A  1649                                                      
REMARK 465     ASP A  1650                                                      
REMARK 465     ALA A  1651                                                      
REMARK 465     ARG A  1652                                                      
REMARK 465     THR A  1653                                                      
REMARK 465     ASN A  1654                                                      
REMARK 465     PRO A  1655                                                      
REMARK 465     LEU A  1656                                                      
REMARK 465     ALA A  1657                                                      
REMARK 465     ARG A  1658                                                      
REMARK 465     ALA A  1659                                                      
REMARK 465     ASN A  1660                                                      
REMARK 465     THR A  1661                                                      
REMARK 465     ASN A  1662                                                      
REMARK 465     ASN A  1663                                                      
REMARK 465     ALA A  1664                                                      
REMARK 465     ASN A  1665                                                      
REMARK 465     ALA A  1666                                                      
REMARK 465     ASN A  1667                                                      
REMARK 465     VAL A  1668                                                      
REMARK 465     ALA A  1669                                                      
REMARK 465     TYR A  1670                                                      
REMARK 465     GLY A  1671                                                      
REMARK 465     ASN A  1672                                                      
REMARK 465     SER A  1673                                                      
REMARK 465     ASN A  1674                                                      
REMARK 465     HIS A  1675                                                      
REMARK 465     SER A  1676                                                      
REMARK 465     ASN A  1677                                                      
REMARK 465     ASN A  1678                                                      
REMARK 465     GLN A  1679                                                      
REMARK 465     MET A  1680                                                      
REMARK 465     PHE A  1681                                                      
REMARK 465     SER A  1682                                                      
REMARK 465     SER A  1683                                                      
REMARK 465     VAL A  1684                                                      
REMARK 465     HIS A  1685                                                      
REMARK 465     CYS A  1686                                                      
REMARK 465     GLU A  1687                                                      
REMARK 465     ARG A  1688                                                      
REMARK 465     GLU A  1689                                                      
REMARK 465     PHE A  1690                                                      
REMARK 465     PRO A  1691                                                      
REMARK 465     GLY A  1692                                                      
REMARK 465     GLU A  1693                                                      
REMARK 465     ALA A  1694                                                      
REMARK 465     GLU A  1695                                                      
REMARK 465     THR A  1696                                                      
REMARK 465     PRO A  1697                                                      
REMARK 465     ALA A  1698                                                      
REMARK 465     ALA A  1699                                                      
REMARK 465     GLY A  1700                                                      
REMARK 465     ARG A  1701                                                      
REMARK 465     GLY A  1702                                                      
REMARK 465     ALA A  1703                                                      
REMARK 465     LEU A  1704                                                      
REMARK 465     SER A  1705                                                      
REMARK 465     HIS A  1706                                                      
REMARK 465     SER A  1707                                                      
REMARK 465     HIS A  1708                                                      
REMARK 465     ARG A  1709                                                      
REMARK 465     ALA A  1710                                                      
REMARK 465     LEU A  1711                                                      
REMARK 465     GLY A  1712                                                      
REMARK 465     PRO A  1713                                                      
REMARK 465     HIS A  1714                                                      
REMARK 465     SER A  1715                                                      
REMARK 465     LYS A  1716                                                      
REMARK 465     PRO A  1717                                                      
REMARK 465     CYS A  1718                                                      
REMARK 465     ALA A  1719                                                      
REMARK 465     GLY A  1720                                                      
REMARK 465     LYS A  1721                                                      
REMARK 465     LEU A  1722                                                      
REMARK 465     ASN A  1723                                                      
REMARK 465     GLY A  1724                                                      
REMARK 465     GLN A  1725                                                      
REMARK 465     LEU A  1726                                                      
REMARK 465     VAL A  1727                                                      
REMARK 465     GLN A  1728                                                      
REMARK 465     PRO A  1729                                                      
REMARK 465     GLY A  1730                                                      
REMARK 465     MET A  1731                                                      
REMARK 465     PRO A  1732                                                      
REMARK 465     ILE A  1733                                                      
REMARK 465     ASN A  1734                                                      
REMARK 465     GLN A  1735                                                      
REMARK 465     ALA A  1736                                                      
REMARK 465     PRO A  1737                                                      
REMARK 465     PRO A  1738                                                      
REMARK 465     ALA A  1739                                                      
REMARK 465     PRO A  1740                                                      
REMARK 465     CYS A  1741                                                      
REMARK 465     GLN A  1742                                                      
REMARK 465     GLN A  1743                                                      
REMARK 465     PRO A  1744                                                      
REMARK 465     SER A  1745                                                      
REMARK 465     THR A  1746                                                      
REMARK 465     ASP A  1747                                                      
REMARK 465     PRO A  1748                                                      
REMARK 465     PRO A  1749                                                      
REMARK 465     GLU A  1750                                                      
REMARK 465     ARG A  1751                                                      
REMARK 465     GLY A  1752                                                      
REMARK 465     GLN A  1753                                                      
REMARK 465     ARG A  1754                                                      
REMARK 465     ARG A  1755                                                      
REMARK 465     THR A  1756                                                      
REMARK 465     SER A  1757                                                      
REMARK 465     LEU A  1758                                                      
REMARK 465     THR A  1759                                                      
REMARK 465     GLY A  1760                                                      
REMARK 465     SER A  1761                                                      
REMARK 465     LEU A  1762                                                      
REMARK 465     GLN A  1763                                                      
REMARK 465     ASP A  1764                                                      
REMARK 465     GLU A  1765                                                      
REMARK 465     ALA A  1766                                                      
REMARK 465     PRO A  1767                                                      
REMARK 465     GLN A  1768                                                      
REMARK 465     ARG A  1769                                                      
REMARK 465     ARG A  1770                                                      
REMARK 465     SER A  1771                                                      
REMARK 465     SER A  1772                                                      
REMARK 465     GLU A  1773                                                      
REMARK 465     GLY A  1774                                                      
REMARK 465     SER A  1775                                                      
REMARK 465     THR A  1776                                                      
REMARK 465     PRO A  1777                                                      
REMARK 465     ARG A  1778                                                      
REMARK 465     ARG A  1779                                                      
REMARK 465     PRO A  1780                                                      
REMARK 465     ALA A  1781                                                      
REMARK 465     PRO A  1782                                                      
REMARK 465     ALA A  1783                                                      
REMARK 465     THR A  1784                                                      
REMARK 465     ALA A  1785                                                      
REMARK 465     LEU A  1786                                                      
REMARK 465     LEU A  1787                                                      
REMARK 465     ILE A  1788                                                      
REMARK 465     GLN A  1789                                                      
REMARK 465     GLU A  1790                                                      
REMARK 465     ALA A  1791                                                      
REMARK 465     LEU A  1792                                                      
REMARK 465     VAL A  1793                                                      
REMARK 465     ARG A  1794                                                      
REMARK 465     GLY A  1795                                                      
REMARK 465     GLY A  1796                                                      
REMARK 465     LEU A  1797                                                      
REMARK 465     ASP A  1798                                                      
REMARK 465     THR A  1799                                                      
REMARK 465     LEU A  1800                                                      
REMARK 465     ALA A  1801                                                      
REMARK 465     ALA A  1802                                                      
REMARK 465     ASP A  1803                                                      
REMARK 465     ALA A  1804                                                      
REMARK 465     GLY A  1805                                                      
REMARK 465     PHE A  1806                                                      
REMARK 465     VAL A  1807                                                      
REMARK 465     THR A  1808                                                      
REMARK 465     ALA A  1809                                                      
REMARK 465     THR A  1810                                                      
REMARK 465     SER A  1811                                                      
REMARK 465     GLN A  1812                                                      
REMARK 465     ALA A  1813                                                      
REMARK 465     LEU A  1814                                                      
REMARK 465     ALA A  1815                                                      
REMARK 465     ASP A  1816                                                      
REMARK 465     ALA A  1817                                                      
REMARK 465     CYS A  1818                                                      
REMARK 465     GLN A  1819                                                      
REMARK 465     MET A  1820                                                      
REMARK 465     GLU A  1821                                                      
REMARK 465     PRO A  1822                                                      
REMARK 465     GLU A  1823                                                      
REMARK 465     GLU A  1824                                                      
REMARK 465     VAL A  1825                                                      
REMARK 465     GLU A  1826                                                      
REMARK 465     VAL A  1827                                                      
REMARK 465     ALA A  1828                                                      
REMARK 465     ALA A  1829                                                      
REMARK 465     THR A  1830                                                      
REMARK 465     GLU A  1831                                                      
REMARK 465     LEU A  1832                                                      
REMARK 465     LEU A  1833                                                      
REMARK 465     LYS A  1834                                                      
REMARK 465     ALA A  1835                                                      
REMARK 465     ARG A  1836                                                      
REMARK 465     GLU A  1837                                                      
REMARK 465     SER A  1838                                                      
REMARK 465     VAL A  1839                                                      
REMARK 465     GLN A  1840                                                      
REMARK 465     GLY A  1841                                                      
REMARK 465     MET A  1842                                                      
REMARK 465     ALA A  1843                                                      
REMARK 465     SER A  1844                                                      
REMARK 465     VAL A  1845                                                      
REMARK 465     PRO A  1846                                                      
REMARK 465     GLY A  1847                                                      
REMARK 465     SER A  1848                                                      
REMARK 465     LEU A  1849                                                      
REMARK 465     SER A  1850                                                      
REMARK 465     ARG A  1851                                                      
REMARK 465     ARG A  1852                                                      
REMARK 465     SER A  1853                                                      
REMARK 465     SER A  1854                                                      
REMARK 465     LEU A  1855                                                      
REMARK 465     GLY A  1856                                                      
REMARK 465     SER A  1857                                                      
REMARK 465     LEU A  1858                                                      
REMARK 465     ASP A  1859                                                      
REMARK 465     GLN A  1860                                                      
REMARK 465     VAL A  1861                                                      
REMARK 465     GLN A  1862                                                      
REMARK 465     GLY A  1863                                                      
REMARK 465     SER A  1864                                                      
REMARK 465     GLN A  1865                                                      
REMARK 465     GLU A  1866                                                      
REMARK 465     THR A  1867                                                      
REMARK 465     LEU A  1868                                                      
REMARK 465     ILE A  1869                                                      
REMARK 465     PRO A  1870                                                      
REMARK 465     PRO A  1871                                                      
REMARK 465     ARG A  1872                                                      
REMARK 465     PRO A  1873                                                      
REMARK 465     GLY B    14                                                      
REMARK 465     HIS B    15                                                      
REMARK 465     MET B    16                                                      
REMARK 465     GLY B    17                                                      
REMARK 465     SER B    18                                                      
REMARK 465     ALA B    19                                                      
REMARK 465     ASP B    20                                                      
REMARK 465     SER B    21                                                      
REMARK 465     TYR B    22                                                      
REMARK 465     THR B    23                                                      
REMARK 465     SER B    24                                                      
REMARK 465     ARG B    25                                                      
REMARK 465     PRO B    26                                                      
REMARK 465     SER B    27                                                      
REMARK 465     ASP B    28                                                      
REMARK 465     SER B    29                                                      
REMARK 465     ASP B    30                                                      
REMARK 465     VAL B    31                                                      
REMARK 465     SER B    32                                                      
REMARK 465     LEU B    33                                                      
REMARK 465     GLU B    34                                                      
REMARK 465     GLU B    35                                                      
REMARK 465     ASP B    36                                                      
REMARK 465     ARG B    37                                                      
REMARK 465     GLU B    38                                                      
REMARK 465     ALA B    39                                                      
REMARK 465     VAL B    40                                                      
REMARK 465     GLN B   192                                                      
REMARK 465     GLY B   193                                                      
REMARK 465     LYS B   194                                                      
REMARK 465     PHE B   195                                                      
REMARK 465     TYR B   196                                                      
REMARK 465     SER B   197                                                      
REMARK 465     SER B   198                                                      
REMARK 465     LYS B   199                                                      
REMARK 465     SER B   200                                                      
REMARK 465     MET B   201                                                      
REMARK 465     SER B   202                                                      
REMARK 465     LYS B   203                                                      
REMARK 465     GLU B   204                                                      
REMARK 465     LYS B   205                                                      
REMARK 465     ARG B   206                                                      
REMARK 465     MET B   207                                                      
REMARK 465     PRO B   208                                                      
REMARK 465     PHE B   209                                                      
REMARK 465     LYS B   212                                                      
REMARK 465     LYS B   213                                                      
REMARK 465     THR B   214                                                      
REMARK 465     GLU B   215                                                      
REMARK 465     HIS B   216                                                      
REMARK 465     ARG B   275                                                      
REMARK 465     SER B   276                                                      
REMARK 465     VAL B   277                                                      
REMARK 465     LEU B   278                                                      
REMARK 465     ASN B   279                                                      
REMARK 465     ASN B   280                                                      
REMARK 465     PRO B   281                                                      
REMARK 465     SER B   282                                                      
REMARK 465     LYS B   283                                                      
REMARK 465     HIS B   284                                                      
REMARK 465     GLY B   357                                                      
REMARK 465     LYS B   358                                                      
REMARK 465     SER B   359                                                      
REMARK 465     GLN B   360                                                      
REMARK 465     ALA B   361                                                      
REMARK 465     LYS B   362                                                      
REMARK 465     LEU B   417                                                      
REMARK 465     PRO B   418                                                      
REMARK 465     ASN B   419                                                      
REMARK 465     PRO B   420                                                      
REMARK 465     LEU B   421                                                      
REMARK 465     LEU B   422                                                      
REMARK 465     SER B   423                                                      
REMARK 465     ARG B   424                                                      
REMARK 465     THR B   425                                                      
REMARK 465     PRO E    37                                                      
REMARK 465     HIS E    38                                                      
REMARK 465     MET E    39                                                      
REMARK 465     GLU E    40                                                      
REMARK 465     ASN E    41                                                      
REMARK 465     HIS E    42                                                      
REMARK 465     ASN E    43                                                      
REMARK 465     THR E    44                                                      
REMARK 465     THR E    45                                                      
REMARK 465     CYS E    46                                                      
REMARK 465     GLU E    47                                                      
REMARK 465     ALA E    48                                                      
REMARK 465     ALA E    49                                                      
REMARK 465     HIS E    50                                                      
REMARK 465     PHE E    51                                                      
REMARK 465     GLY E    52                                                      
REMARK 465     LEU E    53                                                      
REMARK 465     TRP E    54                                                      
REMARK 465     ARG E    55                                                      
REMARK 465     ILE E    56                                                      
REMARK 465     CYS E    57                                                      
REMARK 465     THR E    58                                                      
REMARK 465     LYS E    59                                                      
REMARK 465     ARG E    60                                                      
REMARK 465     ILE E    61                                                      
REMARK 465     ALA E    62                                                      
REMARK 465     LEU E    63                                                      
REMARK 465     GLY E    64                                                      
REMARK 465     GLU E    65                                                      
REMARK 465     ASP E    66                                                      
REMARK 465     ARG E    67                                                      
REMARK 465     SER E    68                                                      
REMARK 465     CYS E    69                                                      
REMARK 465     GLY E    70                                                      
REMARK 465     PRO E    71                                                      
REMARK 465     ILE E    72                                                      
REMARK 465     THR E    73                                                      
REMARK 465     LEU E    74                                                      
REMARK 465     PRO E    75                                                      
REMARK 465     GLY E    76                                                      
REMARK 465     GLU E    77                                                      
REMARK 465     LYS E    78                                                      
REMARK 465     ASN E    79                                                      
REMARK 465     CYS E    80                                                      
REMARK 465     SER E    81                                                      
REMARK 465     TYR E    82                                                      
REMARK 465     PHE E    83                                                      
REMARK 465     ARG E    84                                                      
REMARK 465     HIS E    85                                                      
REMARK 465     PHE E    86                                                      
REMARK 465     ASN E    87                                                      
REMARK 465     PRO E    88                                                      
REMARK 465     GLY E    89                                                      
REMARK 465     GLU E    90                                                      
REMARK 465     SER E    91                                                      
REMARK 465     SER E    92                                                      
REMARK 465     GLU E    93                                                      
REMARK 465     ILE E    94                                                      
REMARK 465     PHE E    95                                                      
REMARK 465     ASP E   167                                                      
REMARK 465     SER E   168                                                      
REMARK 465     GLU E   169                                                      
REMARK 465     ASP E   170                                                      
REMARK 465     THR E   171                                                      
REMARK 465     VAL E   172                                                      
REMARK 465     TRP E   173                                                      
REMARK 465     ILE E   174                                                      
REMARK 465     GLU E   175                                                      
REMARK 465     MET E   207                                                      
REMARK 465     PRO E   208                                                      
REMARK 465     GLN E   209                                                      
REMARK 465     ASN E   210                                                      
REMARK 465     PRO E   211                                                      
REMARK 465     TRP E   212                                                      
REMARK 465     GLU E   213                                                      
REMARK 465     SER E   214                                                      
REMARK 465     CYS E   215                                                      
REMARK 465     MET E   216                                                      
REMARK 465     ASP E   217                                                      
REMARK 465     ALA E   218                                                      
REMARK 465     GLU E   219                                                      
REMARK 465     PRO E   220                                                      
REMARK 465     GLU E   221                                                      
REMARK 465     HIS E   222                                                      
REMARK 465     MET F     1                                                      
REMARK 465     ALA F     2                                                      
REMARK 465     ALA F     3                                                      
REMARK 465     GLY F     4                                                      
REMARK 465     ARG F     5                                                      
REMARK 465     PRO F     6                                                      
REMARK 465     LEU F     7                                                      
REMARK 465     ALA F     8                                                      
REMARK 465     TRP F     9                                                      
REMARK 465     THR F    10                                                      
REMARK 465     LEU F    11                                                      
REMARK 465     THR F    12                                                      
REMARK 465     LEU F    13                                                      
REMARK 465     TRP F    14                                                      
REMARK 465     GLN F    15                                                      
REMARK 465     ALA F    16                                                      
REMARK 465     TRP F    17                                                      
REMARK 465     LEU F    18                                                      
REMARK 465     ILE F    19                                                      
REMARK 465     LEU F    20                                                      
REMARK 465     ILE F    21                                                      
REMARK 465     GLY F    22                                                      
REMARK 465     PRO F    23                                                      
REMARK 465     SER F    24                                                      
REMARK 465     SER F    25                                                      
REMARK 465     GLU F    26                                                      
REMARK 465     GLU F    27                                                      
REMARK 465     PRO F    28                                                      
REMARK 465     PHE F    29                                                      
REMARK 465     PRO F    30                                                      
REMARK 465     SER F    31                                                      
REMARK 465     ALA F    32                                                      
REMARK 465     VAL F    33                                                      
REMARK 465     THR F    34                                                      
REMARK 465     ILE F    35                                                      
REMARK 465     LYS F    36                                                      
REMARK 465     SER F    37                                                      
REMARK 465     TRP F    38                                                      
REMARK 465     VAL F    39                                                      
REMARK 465     ILE F   147                                                      
REMARK 465     LYS F   148                                                      
REMARK 465     PRO F   149                                                      
REMARK 465     VAL F   150                                                      
REMARK 465     PHE F   151                                                      
REMARK 465     ILE F   152                                                      
REMARK 465     ASP F   153                                                      
REMARK 465     ASP F   154                                                      
REMARK 465     ALA F   155                                                      
REMARK 465     ASN F   156                                                      
REMARK 465     PHE F   157                                                      
REMARK 465     ARG F   158                                                      
REMARK 465     ARG F   159                                                      
REMARK 465     GLN F   160                                                      
REMARK 465     VAL F   161                                                      
REMARK 465     VAL F   226                                                      
REMARK 465     ASP F   227                                                      
REMARK 465     ASN F   228                                                      
REMARK 465     SER F   229                                                      
REMARK 465     ARG F   230                                                      
REMARK 465     THR F   231                                                      
REMARK 465     PRO F   232                                                      
REMARK 465     ILE F   534                                                      
REMARK 465     GLY F   535                                                      
REMARK 465     VAL F   536                                                      
REMARK 465     GLY F   537                                                      
REMARK 465     ILE F   538                                                      
REMARK 465     PRO F   539                                                      
REMARK 465     THR F   540                                                      
REMARK 465     ILE F   541                                                      
REMARK 465     ASN F   542                                                      
REMARK 465     LEU F   543                                                      
REMARK 465     ARG F   544                                                      
REMARK 465     LYS F   545                                                      
REMARK 465     ARG F   546                                                      
REMARK 465     ARG F   547                                                      
REMARK 465     PRO F   548                                                      
REMARK 465     ASN F   549                                                      
REMARK 465     VAL F   550                                                      
REMARK 465     GLN F   551                                                      
REMARK 465     ASN F   552                                                      
REMARK 465     ASN F   655                                                      
REMARK 465     PHE F   656                                                      
REMARK 465     GLU F   657                                                      
REMARK 465     GLU F   658                                                      
REMARK 465     SER F   659                                                      
REMARK 465     GLY F   660                                                      
REMARK 465     TYR F   661                                                      
REMARK 465     UNK F   698                                                      
REMARK 465     UNK F   699                                                      
REMARK 465     UNK F   700                                                      
REMARK 465     UNK F   701                                                      
REMARK 465     UNK F   702                                                      
REMARK 465     UNK F   703                                                      
REMARK 465     UNK F   704                                                      
REMARK 465     UNK F   705                                                      
REMARK 465     UNK F   706                                                      
REMARK 465     UNK F   707                                                      
REMARK 465     UNK F   708                                                      
REMARK 465     UNK F   709                                                      
REMARK 465     UNK F   710                                                      
REMARK 465     UNK F   711                                                      
REMARK 465     UNK F   712                                                      
REMARK 465     UNK F   713                                                      
REMARK 465     UNK F   714                                                      
REMARK 465     UNK F   715                                                      
REMARK 465     UNK F   716                                                      
REMARK 465     UNK F   717                                                      
REMARK 465     UNK F   718                                                      
REMARK 465     UNK F   730                                                      
REMARK 465     UNK F   769                                                      
REMARK 465     UNK F   770                                                      
REMARK 465     UNK F   771                                                      
REMARK 465     UNK F   772                                                      
REMARK 465     UNK F   773                                                      
REMARK 465     UNK F   774                                                      
REMARK 465     UNK F   775                                                      
REMARK 465     UNK F   776                                                      
REMARK 465     UNK F   800                                                      
REMARK 465     UNK F   801                                                      
REMARK 465     UNK F   802                                                      
REMARK 465     UNK F   846                                                      
REMARK 465     UNK F   847                                                      
REMARK 465     UNK F   848                                                      
REMARK 465     UNK F   849                                                      
REMARK 465     UNK F   850                                                      
REMARK 465     UNK F   857                                                      
REMARK 465     UNK F   878                                                      
REMARK 465     UNK F   879                                                      
REMARK 465     UNK F   887                                                      
REMARK 465     UNK F   888                                                      
REMARK 465     UNK F   898                                                      
REMARK 465     UNK F   899                                                      
REMARK 465     UNK F   900                                                      
REMARK 465     UNK F   901                                                      
REMARK 465     UNK F   919                                                      
REMARK 465     UNK F   920                                                      
REMARK 465     UNK F   921                                                      
REMARK 465     UNK F   922                                                      
REMARK 465     UNK F   923                                                      
REMARK 465     UNK F   924                                                      
REMARK 465     UNK F   925                                                      
REMARK 465     UNK F   926                                                      
REMARK 465     UNK F   927                                                      
REMARK 465     UNK F   928                                                      
REMARK 465     UNK F   929                                                      
REMARK 465     UNK F   941                                                      
REMARK 465     UNK F   942                                                      
REMARK 465     UNK F   943                                                      
REMARK 465     UNK F   944                                                      
REMARK 465     UNK F   945                                                      
REMARK 465     UNK F   946                                                      
REMARK 465     UNK F   947                                                      
REMARK 465     UNK F   948                                                      
REMARK 465     UNK F   949                                                      
REMARK 465     UNK F   955                                                      
REMARK 465     ARG F   956                                                      
REMARK 465     LEU F   957                                                      
REMARK 465     LEU F   958                                                      
REMARK 465     GLU F   959                                                      
REMARK 465     ALA F   960                                                      
REMARK 465     ALA F   961                                                      
REMARK 465     ASP F   962                                                      
REMARK 465     MET F   963                                                      
REMARK 465     GLU F   964                                                      
REMARK 465     ASP F   965                                                      
REMARK 465     ASP F   966                                                      
REMARK 465     ASP F   967                                                      
REMARK 465     PHE F   968                                                      
REMARK 465     THR F   969                                                      
REMARK 465     ALA F   970                                                      
REMARK 465     SER F   971                                                      
REMARK 465     MET F   972                                                      
REMARK 465     SER F   973                                                      
REMARK 465     LYS F   974                                                      
REMARK 465     GLN F   975                                                      
REMARK 465     SER F   976                                                      
REMARK 465     SER F   990                                                      
REMARK 465     LYS F   991                                                      
REMARK 465     SER F   992                                                      
REMARK 465     PHE F   993                                                      
REMARK 465     SER F   994                                                      
REMARK 465     GLY F   995                                                      
REMARK 465     VAL F   996                                                      
REMARK 465     LEU F   997                                                      
REMARK 465     MET F  1020                                                      
REMARK 465     VAL F  1021                                                      
REMARK 465     GLU F  1022                                                      
REMARK 465     SER F  1023                                                      
REMARK 465     LYS F  1024                                                      
REMARK 465     GLY F  1025                                                      
REMARK 465     THR F  1026                                                      
REMARK 465     CYS F  1027                                                      
REMARK 465     ASN F  1065                                                      
REMARK 465     ASN F  1066                                                      
REMARK 465     VAL F  1067                                                      
REMARK 465     LEU F  1068                                                      
REMARK 465     GLU F  1069                                                      
REMARK 465     ASP F  1070                                                      
REMARK 465     TYR F  1071                                                      
REMARK 465     THR F  1072                                                      
REMARK 465     ASP F  1073                                                      
REMARK 465     CYS F  1074                                                      
REMARK 465     GLY F  1075                                                      
REMARK 465     GLY F  1076                                                      
REMARK 465     VAL F  1077                                                      
REMARK 465     SER F  1078                                                      
REMARK 465     GLY F  1079                                                      
REMARK 465     LEU F  1080                                                      
REMARK 465     ASN F  1081                                                      
REMARK 465     PRO F  1082                                                      
REMARK 465     SER F  1083                                                      
REMARK 465     LEU F  1084                                                      
REMARK 465     TRP F  1085                                                      
REMARK 465     SER F  1086                                                      
REMARK 465     ILE F  1087                                                      
REMARK 465     ILE F  1088                                                      
REMARK 465     GLY F  1089                                                      
REMARK 465     ILE F  1090                                                      
REMARK 465     GLN F  1091                                                      
REMARK 465     PHE F  1092                                                      
REMARK 465     VAL F  1093                                                      
REMARK 465     LEU F  1094                                                      
REMARK 465     LEU F  1095                                                      
REMARK 465     TRP F  1096                                                      
REMARK 465     LEU F  1097                                                      
REMARK 465     VAL F  1098                                                      
REMARK 465     SER F  1099                                                      
REMARK 465     GLY F  1100                                                      
REMARK 465     SER F  1101                                                      
REMARK 465     ARG F  1102                                                      
REMARK 465     HIS F  1103                                                      
REMARK 465     CYS F  1104                                                      
REMARK 465     LEU F  1105                                                      
REMARK 465     LEU F  1106                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     PHE A  32    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS A  33    SG                                                  
REMARK 470     LEU A  34    CG   CD1  CD2                                       
REMARK 470     THR A  35    OG1  CG2                                            
REMARK 470     LEU A  36    CG   CD1  CD2                                       
REMARK 470     GLN A  37    CG   CD   OE1  NE2                                  
REMARK 470     ASN A  38    CG   OD1  ND2                                       
REMARK 470     PRO A  39    CG   CD                                             
REMARK 470     LEU A  40    CG   CD1  CD2                                       
REMARK 470     ARG A  41    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS A  42    CG   CD   CE   NZ                                   
REMARK 470     CYS A  44    SG                                                  
REMARK 470     ILE A  45    CG1  CG2  CD1                                       
REMARK 470     SER A  46    OG                                                  
REMARK 470     ILE A  47    CG1  CG2  CD1                                       
REMARK 470     VAL A  48    CG1  CG2                                            
REMARK 470     GLU A  49    CG   CD   OE1  OE2                                  
REMARK 470     TRP A  50    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A  50    CZ3  CH2                                            
REMARK 470     TYR A  71    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU A  72    CG   CD1  CD2                                       
REMARK 470     PRO A  73    CG   CD                                             
REMARK 470     MET A  74    CG   SD   CE                                        
REMARK 470     PRO A  75    CG   CD                                             
REMARK 470     GLU A  76    CG   CD   OE1  OE2                                  
REMARK 470     ASP A  77    CG   OD1  OD2                                       
REMARK 470     ASP A  78    CG   OD1  OD2                                       
REMARK 470     ASN A  79    CG   OD1  ND2                                       
REMARK 470     ASN A  80    CG   OD1  ND2                                       
REMARK 470     SER A  81    OG                                                  
REMARK 470     LEU A  82    CG   CD1  CD2                                       
REMARK 470     ASN A  83    CG   OD1  ND2                                       
REMARK 470     MET A 103    CG   SD   CE                                        
REMARK 470     LYS A 104    CG   CD   CE   NZ                                   
REMARK 470     ILE A 105    CG1  CG2  CD1                                       
REMARK 470     ILE A 106    CG1  CG2  CD1                                       
REMARK 470     TYR A 108    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE A 110    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU A 111    CG   CD1  CD2                                       
REMARK 470     PHE A 112    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS A 113    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLN A 114    CG   CD   OE1  NE2                                  
REMARK 470     ASP A 115    CG   OD1  OD2                                       
REMARK 470     TYR A 117    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU A 118    CG   CD1  CD2                                       
REMARK 470     ARG A 119    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER A 120    OG                                                  
REMARK 470     LEU A 139    CG   CD1  CD2                                       
REMARK 470     ILE A 199    CG1  CG2  CD1                                       
REMARK 470     LEU A 201    CG   CD1  CD2                                       
REMARK 470     LEU A 202    CG   CD1  CD2                                       
REMARK 470     VAL A 203    CG1  CG2                                            
REMARK 470     LEU A 204    CG   CD1  CD2                                       
REMARK 470     PHE A 205    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     MET A 206    CG   SD   CE                                        
REMARK 470     VAL A 207    CG1  CG2                                            
REMARK 470     ILE A 208    CG1  CG2  CD1                                       
REMARK 470     ILE A 209    CG1  CG2  CD1                                       
REMARK 470     ILE A 212    CG1  CG2  CD1                                       
REMARK 470     ILE A 213    CG1  CG2  CD1                                       
REMARK 470     LEU A 215    CG   CD1  CD2                                       
REMARK 470     PHE A 218    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LYS A 219    CG   CD   CE   NZ                                   
REMARK 470     LYS A 221    CG   CD   CE   NZ                                   
REMARK 470     MET A 222    CG   SD   CE                                        
REMARK 470     HIS A 223    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LYS A 224    CG   CD   CE   NZ                                   
REMARK 470     THR A 225    OG1  CG2                                            
REMARK 470     CYS A 226    SG                                                  
REMARK 470     TYR A 227    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TYR A 228    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ILE A 229    CG1  CG2  CD1                                       
REMARK 470     THR A 231    OG1  CG2                                            
REMARK 470     ASP A 232    CG   OD1  OD2                                       
REMARK 470     ILE A 233    CG1  CG2  CD1                                       
REMARK 470     VAL A 234    CG1  CG2                                            
REMARK 470     THR A 236    OG1  CG2                                            
REMARK 470     VAL A 237    CG1  CG2                                            
REMARK 470     GLU A 238    CG   CD   OE1  OE2                                  
REMARK 470     ASN A 239    CG   OD1  ND2                                       
REMARK 470     GLU A 240    CG   CD   OE1  OE2                                  
REMARK 470     LYS A 241    CG   CD   CE   NZ                                   
REMARK 470     PRO A 242    CG   CD                                             
REMARK 470     SER A 243    OG                                                  
REMARK 470     PRO A 244    CG   CD                                             
REMARK 470     CYS A 245    SG                                                  
REMARK 470     ARG A 247    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR A 248    OG1  CG2                                            
REMARK 470     SER A 250    OG                                                  
REMARK 470     ARG A 252    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO A 253    CG   CD                                             
REMARK 470     CYS A 254    SG                                                  
REMARK 470     THR A 255    OG1  CG2                                            
REMARK 470     ILE A 256    CG1  CG2  CD1                                       
REMARK 470     ASN A 257    CG   OD1  ND2                                       
REMARK 470     SER A 259    OG                                                  
REMARK 470     GLU A 260    CG   CD   OE1  OE2                                  
REMARK 470     CYS A 261    SG                                                  
REMARK 470     ARG A 262    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO A 266    CG   CD                                             
REMARK 470     PRO A 268    CG   CD                                             
REMARK 470     ASN A 269    CB   CG   OD1  ND2                                  
REMARK 470     HIS A 270    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ILE A 272    CG1  CG2  CD1                                       
REMARK 470     TRP A 309    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A 309    CZ3  CH2                                            
REMARK 470     LEU A 333    CG   CD1  CD2                                       
REMARK 470     SER A 334    OG                                                  
REMARK 470     GLU A 336    CG   CD   OE1  OE2                                  
REMARK 470     PHE A 337    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     THR A 338    OG1  CG2                                            
REMARK 470     LYS A 339    CG   CD   CE   NZ                                   
REMARK 470     GLU A 340    CG   CD   OE1  OE2                                  
REMARK 470     ARG A 341    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU A 342    CG   CD   OE1  OE2                                  
REMARK 470     LYS A 343    CG   CD   CE   NZ                                   
REMARK 470     CYS A 425    SG                                                  
REMARK 470     HIS A 426    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASP A 427    CG   OD1  OD2                                       
REMARK 470     LEU A 428    CG   CD1  CD2                                       
REMARK 470     VAL A 429    CG1  CG2                                            
REMARK 470     LYS A 430    CG   CD   CE   NZ                                   
REMARK 470     SER A 431    OG                                                  
REMARK 470     ARG A 432    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL A 433    CG1  CG2                                            
REMARK 470     PHE A 434    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     TYR A 435    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TRP A 436    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A 436    CZ3  CH2                                            
REMARK 470     LEU A 437    CG   CD1  CD2                                       
REMARK 470     VAL A 438    CG1  CG2                                            
REMARK 470     ILE A 439    CG1  CG2  CD1                                       
REMARK 470     LEU A 440    CG   CD1  CD2                                       
REMARK 470     ILE A 441    CG1  CG2  CD1                                       
REMARK 470     VAL A 442    CG1  CG2                                            
REMARK 470     LEU A 444    CG   CD1  CD2                                       
REMARK 470     ASN A 445    CG   OD1  ND2                                       
REMARK 470     THR A 446    OG1  CG2                                            
REMARK 470     LEU A 447    CG   CD1  CD2                                       
REMARK 470     SER A 448    OG                                                  
REMARK 470     ILE A 449    CG1  CG2  CD1                                       
REMARK 470     SER A 451    OG                                                  
REMARK 470     GLU A 452    CG   CD   OE1  OE2                                  
REMARK 470     HIS A 453    CG   ND1  CD2  CE1  NE2                             
REMARK 470     HIS A 454    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASN A 455    CG   OD1  ND2                                       
REMARK 470     GLN A 456    CG   CD   OE1  NE2                                  
REMARK 470     PRO A 457    CG   CD                                             
REMARK 470     LEU A 458    CG   CD1  CD2                                       
REMARK 470     TRP A 459    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A 459    CZ3  CH2                                            
REMARK 470     LEU A 460    CG   CD1  CD2                                       
REMARK 470     THR A 461    OG1  CG2                                            
REMARK 470     HIS A 462    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU A 463    CG   CD1  CD2                                       
REMARK 470     GLN A 464    CG   CD   OE1  NE2                                  
REMARK 470     ASP A 465    CG   OD1  OD2                                       
REMARK 470     ILE A 466    CG1  CG2  CD1                                       
REMARK 470     ASN A 468    CG   OD1  ND2                                       
REMARK 470     ARG A 469    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL A 470    CG1  CG2                                            
REMARK 470     LEU A 471    CG   CD1  CD2                                       
REMARK 470     LEU A 472    CG   CD1  CD2                                       
REMARK 470     SER A 473    OG                                                  
REMARK 470     LEU A 474    CG   CD1  CD2                                       
REMARK 470     PHE A 475    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     THR A 476    OG1  CG2                                            
REMARK 470     ILE A 477    CG1  CG2  CD1                                       
REMARK 470     GLU A 478    CG   CD   OE1  OE2                                  
REMARK 470     MET A 479    CG   SD   CE                                        
REMARK 470     LEU A 480    CG   CD1  CD2                                       
REMARK 470     LEU A 481    CG   CD1  CD2                                       
REMARK 470     LYS A 482    CG   CD   CE   NZ                                   
REMARK 470     MET A 483    CG   SD   CE                                        
REMARK 470     TYR A 484    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU A 486    CG   CD1  CD2                                       
REMARK 470     LEU A 488    CG   CD1  CD2                                       
REMARK 470     ARG A 489    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN A 490    CG   CD   OE1  NE2                                  
REMARK 470     TYR A 491    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE A 492    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     MET A 493    CG   SD   CE                                        
REMARK 470     SER A 494    OG                                                  
REMARK 470     ILE A 495    CG1  CG2  CD1                                       
REMARK 470     PHE A 496    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASN A 497    CG   OD1  ND2                                       
REMARK 470     ARG A 498    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE A 499    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP A 500    CG   OD1  OD2                                       
REMARK 470     CYS A 501    SG                                                  
REMARK 470     PHE A 502    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL A 503    CG1  CG2                                            
REMARK 470     VAL A 504    CG1  CG2                                            
REMARK 470     CYS A 505    SG                                                  
REMARK 470     SER A 506    OG                                                  
REMARK 470     ILE A 508    CG1  CG2  CD1                                       
REMARK 470     LEU A 509    CG   CD1  CD2                                       
REMARK 470     GLU A 510    CG   CD   OE1  OE2                                  
REMARK 470     LEU A 511    CG   CD1  CD2                                       
REMARK 470     LEU A 512    CG   CD1  CD2                                       
REMARK 470     LEU A 513    CG   CD1  CD2                                       
REMARK 470     VAL A 514    CG1  CG2                                            
REMARK 470     GLU A 515    CG   CD   OE1  OE2                                  
REMARK 470     SER A 516    OG                                                  
REMARK 470     MET A 519    CG   SD   CE                                        
REMARK 470     THR A 520    OG1  CG2                                            
REMARK 470     PRO A 521    CG   CD                                             
REMARK 470     LEU A 522    CG   CD1  CD2                                       
REMARK 470     ILE A 524    CG1  CG2  CD1                                       
REMARK 470     SER A 525    OG                                                  
REMARK 470     VAL A 526    CG1  CG2                                            
REMARK 470     LEU A 527    CG   CD1  CD2                                       
REMARK 470     ARG A 528    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     CYS A 529    SG                                                  
REMARK 470     ILE A 530    CG1  CG2  CD1                                       
REMARK 470     ARG A 531    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU A 532    CG   CD1  CD2                                       
REMARK 470     LEU A 533    CG   CD1  CD2                                       
REMARK 470     ARG A 534    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU A 535    CG   CD1  CD2                                       
REMARK 470     PHE A 536    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LYS A 537    CG   CD   CE   NZ                                   
REMARK 470     ILE A 538    CG1  CG2  CD1                                       
REMARK 470     THR A 539    OG1  CG2                                            
REMARK 470     LYS A 540    CG   CD   CE   NZ                                   
REMARK 470     TYR A 541    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TRP A 542    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A 542    CZ3  CH2                                            
REMARK 470     THR A 543    OG1  CG2                                            
REMARK 470     SER A 544    OG                                                  
REMARK 470     LEU A 545    CG   CD1  CD2                                       
REMARK 470     SER A 546    OG                                                  
REMARK 470     ASN A 547    CG   OD1  ND2                                       
REMARK 470     LEU A 548    CG   CD1  CD2                                       
REMARK 470     VAL A 549    CG1  CG2                                            
REMARK 470     SER A 551    OG                                                  
REMARK 470     LEU A 552    CG   CD1  CD2                                       
REMARK 470     LEU A 553    CG   CD1  CD2                                       
REMARK 470     ASN A 554    CG   OD1  ND2                                       
REMARK 470     SER A 555    OG                                                  
REMARK 470     ILE A 556    CG1  CG2  CD1                                       
REMARK 470     ARG A 557    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER A 558    OG                                                  
REMARK 470     ILE A 559    CG1  CG2  CD1                                       
REMARK 470     SER A 561    OG                                                  
REMARK 470     LEU A 562    CG   CD1  CD2                                       
REMARK 470     LEU A 563    CG   CD1  CD2                                       
REMARK 470     LEU A 564    CG   CD1  CD2                                       
REMARK 470     LEU A 565    CG   CD1  CD2                                       
REMARK 470     LEU A 566    CG   CD1  CD2                                       
REMARK 470     PHE A 567    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU A 568    CG   CD1  CD2                                       
REMARK 470     PHE A 569    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE A 570    CG1  CG2  CD1                                       
REMARK 470     ILE A 571    CG1  CG2  CD1                                       
REMARK 470     ILE A 572    CG1  CG2  CD1                                       
REMARK 470     PHE A 573    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU A 575    CG   CD1  CD2                                       
REMARK 470     LEU A 576    CG   CD1  CD2                                       
REMARK 470     MET A 578    CG   SD   CE                                        
REMARK 470     TYR A 585    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASP A 586    CG   OD1  OD2                                       
REMARK 470     PHE A 587    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLU A 588    CG   CD   OE1  OE2                                  
REMARK 470     ASP A 589    CG   OD1  OD2                                       
REMARK 470     THR A 590    OG1  CG2                                            
REMARK 470     GLU A 591    CG   CD   OE1  OE2                                  
REMARK 470     VAL A 592    CG1  CG2                                            
REMARK 470     ARG A 593    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG A 594    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER A 669    OG                                                  
REMARK 470     THR A 799    OG1  CG2                                            
REMARK 470     TRP A 800    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A 800    CZ3  CH2                                            
REMARK 470     PHE A 801    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     THR A 802    OG1  CG2                                            
REMARK 470     ASN A 803    CG   OD1  ND2                                       
REMARK 470     PHE A 804    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE A 805    CG1  CG2  CD1                                       
REMARK 470     LEU A 806    CG   CD1  CD2                                       
REMARK 470     LEU A 807    CG   CD1  CD2                                       
REMARK 470     PHE A 808    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE A 809    CG1  CG2  CD1                                       
REMARK 470     LEU A 810    CG   CD1  CD2                                       
REMARK 470     LEU A 811    CG   CD1  CD2                                       
REMARK 470     SER A 812    OG                                                  
REMARK 470     SER A 813    OG                                                  
REMARK 470     LEU A 816    CG   CD1  CD2                                       
REMARK 470     GLU A 819    CG   CD   OE1  OE2                                  
REMARK 470     ASP A 820    CG   OD1  OD2                                       
REMARK 470     PRO A 821    CG   CD                                             
REMARK 470     ILE A 822    CG1  CG2  CD1                                       
REMARK 470     ARG A 823    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU A 825    CG   CD   OE1  OE2                                  
REMARK 470     SER A 826    OG                                                  
REMARK 470     VAL A 827    CG1  CG2                                            
REMARK 470     ARG A 828    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN A 829    CG   OD1  ND2                                       
REMARK 470     GLN A 830    CG   CD   OE1  NE2                                  
REMARK 470     ILE A 831    CG1  CG2  CD1                                       
REMARK 470     LEU A 832    CG   CD1  CD2                                       
REMARK 470     TYR A 834    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE A 835    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP A 836    CG   OD1  OD2                                       
REMARK 470     ILE A 837    CG1  CG2  CD1                                       
REMARK 470     PHE A 839    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     THR A 840    OG1  CG2                                            
REMARK 470     SER A 841    OG                                                  
REMARK 470     VAL A 842    CG1  CG2                                            
REMARK 470     PHE A 843    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     THR A 844    OG1  CG2                                            
REMARK 470     VAL A 845    CG1  CG2                                            
REMARK 470     GLU A 846    CG   CD   OE1  OE2                                  
REMARK 470     ILE A 847    CG1  CG2  CD1                                       
REMARK 470     VAL A 848    CG1  CG2                                            
REMARK 470     LEU A 849    CG   CD1  CD2                                       
REMARK 470     LYS A 850    CG   CD   CE   NZ                                   
REMARK 470     MET A 851    CG   SD   CE                                        
REMARK 470     THR A 852    OG1  CG2                                            
REMARK 470     THR A 853    OG1  CG2                                            
REMARK 470     TYR A 854    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE A 857    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU A 858    CG   CD1  CD2                                       
REMARK 470     HIS A 859    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LYS A 860    CG   CD   CE   NZ                                   
REMARK 470     SER A 862    OG                                                  
REMARK 470     PHE A 863    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS A 864    SG                                                  
REMARK 470     ARG A 865    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN A 866    CG   OD1  ND2                                       
REMARK 470     TYR A 867    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE A 868    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASN A 869    CG   OD1  ND2                                       
REMARK 470     ILE A 870    CG1  CG2  CD1                                       
REMARK 470     LEU A 871    CG   CD1  CD2                                       
REMARK 470     ASP A 872    CG   OD1  OD2                                       
REMARK 470     LEU A 873    CG   CD1  CD2                                       
REMARK 470     LEU A 874    CG   CD1  CD2                                       
REMARK 470     VAL A 875    CG1  CG2                                            
REMARK 470     VAL A 876    CG1  CG2                                            
REMARK 470     VAL A 878    CG1  CG2                                            
REMARK 470     SER A 879    OG                                                  
REMARK 470     LEU A 880    CG   CD1  CD2                                       
REMARK 470     ILE A 881    CG1  CG2  CD1                                       
REMARK 470     SER A 882    OG                                                  
REMARK 470     MET A 883    CG   SD   CE                                        
REMARK 470     LEU A 885    CG   CD1  CD2                                       
REMARK 470     GLU A 886    CG   CD   OE1  OE2                                  
REMARK 470     SER A 887    OG                                                  
REMARK 470     SER A 888    OG                                                  
REMARK 470     THR A 889    OG1  CG2                                            
REMARK 470     ILE A 890    CG1  CG2  CD1                                       
REMARK 470     SER A 891    OG                                                  
REMARK 470     VAL A 892    CG1  CG2                                            
REMARK 470     VAL A 893    CG1  CG2                                            
REMARK 470     LYS A 894    CG   CD   CE   NZ                                   
REMARK 470     ILE A 895    CG1  CG2  CD1                                       
REMARK 470     LEU A 896    CG   CD1  CD2                                       
REMARK 470     ARG A 897    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL A 898    CG1  CG2                                            
REMARK 470     LEU A 899    CG   CD1  CD2                                       
REMARK 470     ARG A 900    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL A 901    CG1  CG2                                            
REMARK 470     LEU A 902    CG   CD1  CD2                                       
REMARK 470     ARG A 903    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO A 904    CG   CD                                             
REMARK 470     LEU A 905    CG   CD1  CD2                                       
REMARK 470     ARG A 906    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE A 908    CG1  CG2  CD1                                       
REMARK 470     ASN A 909    CG   OD1  ND2                                       
REMARK 470     ARG A 910    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS A 912    CG   CD   CE   NZ                                   
REMARK 470     LEU A 914    CG   CD1  CD2                                       
REMARK 470     LYS A 915    CG   CD   CE   NZ                                   
REMARK 470     HIS A 916    CG   ND1  CD2  CE1  NE2                             
REMARK 470     VAL A 917    CG1  CG2                                            
REMARK 470     VAL A 918    CG1  CG2                                            
REMARK 470     GLN A 919    CG   CD   OE1  NE2                                  
REMARK 470     CYS A 920    SG                                                  
REMARK 470     VAL A 921    CG1  CG2                                            
REMARK 470     PHE A 922    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL A 923    CG1  CG2                                            
REMARK 470     ILE A 925    CG1  CG2  CD1                                       
REMARK 470     THR A 927    OG1  CG2                                            
REMARK 470     ILE A 928    CG1  CG2  CD1                                       
REMARK 470     ASN A 930    CG   OD1  ND2                                       
REMARK 470     LYS A 951    CG   CD   CE   NZ                                   
REMARK 470     LYS A 953    CG   CD   CE   NZ                                   
REMARK 470     PHE A 955    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS A 957    SG                                                  
REMARK 470     ASP A 959    CG   OD1  OD2                                       
REMARK 470     LEU A 960    CG   CD1  CD2                                       
REMARK 470     SER A 961    OG                                                  
REMARK 470     LYS A 962    CG   CD   CE   NZ                                   
REMARK 470     MET A 963    CG   SD   CE                                        
REMARK 470     THR A 964    OG1  CG2                                            
REMARK 470     GLU A 965    CG   CD   OE1  OE2                                  
REMARK 470     GLU A 966    CG   CD   OE1  OE2                                  
REMARK 470     GLU A 967    CG   CD   OE1  OE2                                  
REMARK 470     PRO A 987    CG   CD                                             
REMARK 470     ARG A 988    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN A 989    CG   CD   OE1  NE2                                  
REMARK 470     TRP A 990    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A 990    CZ3  CH2                                            
REMARK 470     ILE A 991    CG1  CG2  CD1                                       
REMARK 470     HIS A 992    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASN A 993    CG   OD1  ND2                                       
REMARK 470     ASP A 994    CG   OD1  OD2                                       
REMARK 470     GLU A1028    CG   CD   OE1  OE2                                  
REMARK 470     GLU A1029    CG   CD   OE1  OE2                                  
REMARK 470     ASP A1030    CG   OD1  OD2                                       
REMARK 470     MET A1031    CG   SD   CE                                        
REMARK 470     PRO A1033    CG   CD                                             
REMARK 470     VAL A1034    CG1  CG2                                            
REMARK 470     TYR A1035    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASN A1036    CG   OD1  ND2                                       
REMARK 470     ASN A1037    CG   OD1  ND2                                       
REMARK 470     ARG A1038    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL A1039    CG1  CG2                                            
REMARK 470     GLU A1040    CG   CD   OE1  OE2                                  
REMARK 470     MET A1041    CG   SD   CE                                        
REMARK 470     GLN A1071    CG   CD   OE1  NE2                                  
REMARK 470     GLU A1073    CG   CD   OE1  OE2                                  
REMARK 470     THR A1074    OG1  CG2                                            
REMARK 470     GLU A1075    CG   CD   OE1  OE2                                  
REMARK 470     TYR A1076    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PRO A1103    CG   CD                                             
REMARK 470     LYS A1104    CG   CD   CE   NZ                                   
REMARK 470     ASN A1105    CG   OD1  ND2                                       
REMARK 470     PRO A1106    CG   CD                                             
REMARK 470     TYR A1107    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN A1108    CG   CD   OE1  NE2                                  
REMARK 470     TYR A1109    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN A1110    CG   CD   OE1  NE2                                  
REMARK 470     VAL A1111    CG1  CG2                                            
REMARK 470     TRP A1112    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A1112    CZ3  CH2                                            
REMARK 470     TYR A1113    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL A1114    CG1  CG2                                            
REMARK 470     VAL A1115    CG1  CG2                                            
REMARK 470     THR A1116    OG1  CG2                                            
REMARK 470     SER A1117    OG                                                  
REMARK 470     SER A1118    OG                                                  
REMARK 470     TYR A1119    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE A1120    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLU A1121    CG   CD   OE1  OE2                                  
REMARK 470     TYR A1122    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN A1138    CG   CD   OE1  NE2                                  
REMARK 470     HIS A1139    CG   ND1  CD2  CE1  NE2                             
REMARK 470     TYR A1140    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     HIS A1141    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLN A1142    CG   CD   OE1  NE2                                  
REMARK 470     SER A1143    OG                                                  
REMARK 470     GLU A1144    CG   CD   OE1  OE2                                  
REMARK 470     GLU A1145    CG   CD   OE1  OE2                                  
REMARK 470     MET A1146    CG   SD   CE                                        
REMARK 470     ASN A1147    CG   OD1  ND2                                       
REMARK 470     PHE A1172    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LYS A1173    CG   CD   CE   NZ                                   
REMARK 470     ARG A1175    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     TYR A1177    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE A1178    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL A1190    CG1  CG2                                            
REMARK 470     ILE A1195    CG1  CG2  CD1                                       
REMARK 470     GLU A1201    CG   CD   OE1  OE2                                  
REMARK 470     ILE A1202    CG1  CG2  CD1                                       
REMARK 470     ASP A1203    CG   OD1  OD2                                       
REMARK 470     THR A1204    OG1  CG2                                            
REMARK 470     ARG A1229    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE A1230    CG1  CG2  CD1                                       
REMARK 470     SER A1231    OG                                                  
REMARK 470     SER A1232    OG                                                  
REMARK 470     PHE A1234    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ARG A1249    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU A1251    CG   CD   OE1  OE2                                  
REMARK 470     VAL A1253    CG1  CG2                                            
REMARK 470     ARG A1254    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR A1255    OG1  CG2                                            
REMARK 470     LEU A1256    CG   CD1  CD2                                       
REMARK 470     LEU A1257    CG   CD1  CD2                                       
REMARK 470     TRP A1258    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A1258    CZ3  CH2                                            
REMARK 470     THR A1259    OG1  CG2                                            
REMARK 470     PHE A1260    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE A1261    CG1  CG2  CD1                                       
REMARK 470     LYS A1262    CG   CD   CE   NZ                                   
REMARK 470     SER A1263    OG                                                  
REMARK 470     PHE A1264    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLN A1265    CG   CD   OE1  NE2                                  
REMARK 470     LEU A1267    CG   CD1  CD2                                       
REMARK 470     PRO A1268    CG   CD                                             
REMARK 470     TYR A1269    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL A1270    CG1  CG2                                            
REMARK 470     LEU A1272    CG   CD1  CD2                                       
REMARK 470     LEU A1273    CG   CD1  CD2                                       
REMARK 470     ILE A1274    CG1  CG2  CD1                                       
REMARK 470     VAL A1275    CG1  CG2                                            
REMARK 470     MET A1276    CG   SD   CE                                        
REMARK 470     LEU A1277    CG   CD1  CD2                                       
REMARK 470     PHE A1278    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     PHE A1279    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE A1280    CG1  CG2  CD1                                       
REMARK 470     TYR A1281    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL A1283    CG1  CG2                                            
REMARK 470     ILE A1284    CG1  CG2  CD1                                       
REMARK 470     MET A1286    CG   SD   CE                                        
REMARK 470     GLN A1287    CG   CD   OE1  NE2                                  
REMARK 470     MET A1288    CG   SD   CE                                        
REMARK 470     PHE A1289    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LYS A1291    CG   CD   CE   NZ                                   
REMARK 470     ILE A1292    CG1  CG2  CD1                                       
REMARK 470     LEU A1294    CG   CD1  CD2                                       
REMARK 470     VAL A1295    CG1  CG2                                            
REMARK 470     ASP A1296    CG   OD1  OD2                                       
REMARK 470     THR A1298    OG1  CG2                                            
REMARK 470     ASN A1301    CG   OD1  ND2                                       
REMARK 470     ARG A1302    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN A1303    CG   OD1  ND2                                       
REMARK 470     ASN A1304    CG   OD1  ND2                                       
REMARK 470     LYS A1336    CG   CD   CE   NZ                                   
REMARK 470     LEU A1337    CG   CD1  CD2                                       
REMARK 470     CYS A1338    SG                                                  
REMARK 470     ASP A1339    CG   OD1  OD2                                       
REMARK 470     PRO A1340    CG   CD                                             
REMARK 470     GLU A1341    CG   CD   OE1  OE2                                  
REMARK 470     SER A1342    OG                                                  
REMARK 470     ASP A1343    CG   OD1  OD2                                       
REMARK 470     TYR A1344    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PRO A1346    CG   CD                                             
REMARK 470     GLU A1348    CG   CD   OE1  OE2                                  
REMARK 470     GLU A1349    CG   CD   OE1  OE2                                  
REMARK 470     TYR A1350    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     THR A1351    OG1  CG2                                            
REMARK 470     CYS A1352    SG                                                  
REMARK 470     THR A1354    OG1  CG2                                            
REMARK 470     ASN A1355    CG   OD1  ND2                                       
REMARK 470     PHE A1356    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     MET A1381    CG   SD   CE                                        
REMARK 470     ASN A1383    CG   OD1  ND2                                       
REMARK 470     PHE A1384    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP A1385    CG   OD1  OD2                                       
REMARK 470     TYR A1386    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU A1387    CG   CD1  CD2                                       
REMARK 470     THR A1388    OG1  CG2                                            
REMARK 470     ARG A1389    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP A1390    CG   OD1  OD2                                       
REMARK 470     TRP A1391    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A1391    CZ3  CH2                                            
REMARK 470     ILE A1393    CG1  CG2  CD1                                       
REMARK 470     LEU A1394    CG   CD1  CD2                                       
REMARK 470     ARG B  41    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG B  42    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN B  47    CG   CD   OE1  NE2                                  
REMARK 470     LYS B 136    CG   CD   CE   NZ                                   
REMARK 470     LYS B 274    CG   CD   CE   NZ                                   
REMARK 470     GLN B 380    CG   CD   OE1  NE2                                  
REMARK 470     GLU B 381    CG   CD   OE1  OE2                                  
REMARK 470     MET E   1    CG   SD   CE                                        
REMARK 470     SER E   2    OG                                                  
REMARK 470     PRO E   3    CG   CD                                             
REMARK 470     THR E   4    OG1  CG2                                            
REMARK 470     GLU E   5    CG   CD   OE1  OE2                                  
REMARK 470     PRO E   7    CG   CD                                             
REMARK 470     LYS E   8    CG   CD   CE   NZ                                   
REMARK 470     VAL E   9    CG1  CG2                                            
REMARK 470     ARG E  10    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL E  11    CG1  CG2                                            
REMARK 470     THR E  12    OG1  CG2                                            
REMARK 470     LEU E  13    CG   CD1  CD2                                       
REMARK 470     PHE E  14    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS E  15    SG                                                  
REMARK 470     ILE E  16    CG1  CG2  CD1                                       
REMARK 470     LEU E  17    CG   CD1  CD2                                       
REMARK 470     VAL E  18    CG1  CG2                                            
REMARK 470     ILE E  20    CG1  CG2  CD1                                       
REMARK 470     VAL E  21    CG1  CG2                                            
REMARK 470     LEU E  22    CG   CD1  CD2                                       
REMARK 470     MET E  24    CG   SD   CE                                        
REMARK 470     THR E  25    OG1  CG2                                            
REMARK 470     VAL E  27    CG1  CG2                                            
REMARK 470     VAL E  28    CG1  CG2                                            
REMARK 470     SER E  29    OG                                                  
REMARK 470     ASP E  30    CG   OD1  OD2                                       
REMARK 470     HIS E  31    CG   ND1  CD2  CE1  NE2                             
REMARK 470     TRP E  32    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E  32    CZ3  CH2                                            
REMARK 470     VAL E  34    CG1  CG2                                            
REMARK 470     LEU E  35    CG   CD1  CD2                                       
REMARK 470     SER E  36    OG                                                  
REMARK 470     GLU E  96    CG   CD   OE1  OE2                                  
REMARK 470     PHE E  97    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     THR E  98    OG1  CG2                                            
REMARK 470     THR E  99    OG1  CG2                                            
REMARK 470     GLN E 100    CG   CD   OE1  NE2                                  
REMARK 470     LYS E 101    CG   CD   CE   NZ                                   
REMARK 470     GLU E 102    CG   CD   OE1  OE2                                  
REMARK 470     TYR E 103    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     SER E 104    OG                                                  
REMARK 470     ILE E 105    CG1  CG2  CD1                                       
REMARK 470     SER E 106    OG                                                  
REMARK 470     ILE E 110    CG1  CG2  CD1                                       
REMARK 470     SER E 111    OG                                                  
REMARK 470     VAL E 112    CG1  CG2                                            
REMARK 470     PHE E 113    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     SER E 114    OG                                                  
REMARK 470     LEU E 115    CG   CD1  CD2                                       
REMARK 470     PHE E 117    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 118    CG   CD1  CD2                                       
REMARK 470     ILE E 119    CG1  CG2  CD1                                       
REMARK 470     MET E 120    CG   SD   CE                                        
REMARK 470     THR E 122    OG1  CG2                                            
REMARK 470     ILE E 123    CG1  CG2  CD1                                       
REMARK 470     CYS E 124    SG                                                  
REMARK 470     LEU E 126    CG   CD1  CD2                                       
REMARK 470     MET E 127    CG   SD   CE                                        
REMARK 470     PHE E 129    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ARG E 130    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS E 131    CG   CD   CE   NZ                                   
REMARK 470     LYS E 132    CG   CD   CE   NZ                                   
REMARK 470     ARG E 133    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP E 134    CG   OD1  OD2                                       
REMARK 470     TYR E 135    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU E 136    CG   CD1  CD2                                       
REMARK 470     LEU E 137    CG   CD1  CD2                                       
REMARK 470     ARG E 138    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO E 139    CG   CD                                             
REMARK 470     SER E 141    OG                                                  
REMARK 470     MET E 142    CG   SD   CE                                        
REMARK 470     PHE E 143    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     TYR E 144    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL E 145    CG1  CG2                                            
REMARK 470     PHE E 146    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 149    CG   CD1  CD2                                       
REMARK 470     CYS E 150    SG                                                  
REMARK 470     LEU E 151    CG   CD1  CD2                                       
REMARK 470     PHE E 152    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL E 153    CG1  CG2                                            
REMARK 470     SER E 154    OG                                                  
REMARK 470     LEU E 155    CG   CD1  CD2                                       
REMARK 470     GLU E 156    CG   CD   OE1  OE2                                  
REMARK 470     VAL E 157    CG1  CG2                                            
REMARK 470     MET E 158    CG   SD   CE                                        
REMARK 470     ARG E 159    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN E 160    CG   CD   OE1  NE2                                  
REMARK 470     LYS E 163    CG   CD   CE   NZ                                   
REMARK 470     ARG E 164    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     MET E 165    CG   SD   CE                                        
REMARK 470     ILE E 166    CG1  CG2  CD1                                       
REMARK 470     TYR E 176    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TYR E 177    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TYR E 178    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     SER E 179    OG                                                  
REMARK 470     TRP E 180    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 180    CZ3  CH2                                            
REMARK 470     SER E 181    OG                                                  
REMARK 470     PHE E 182    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS E 184    SG                                                  
REMARK 470     CYS E 186    SG                                                  
REMARK 470     PHE E 189    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL E 190    CG1  CG2                                            
REMARK 470     LEU E 191    CG   CD1  CD2                                       
REMARK 470     LEU E 192    CG   CD1  CD2                                       
REMARK 470     PHE E 193    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 194    CG   CD1  CD2                                       
REMARK 470     ILE E 197    CG1  CG2  CD1                                       
REMARK 470     SER E 198    OG                                                  
REMARK 470     LEU E 199    CG   CD1  CD2                                       
REMARK 470     LEU E 200    CG   CD1  CD2                                       
REMARK 470     LEU E 201    CG   CD1  CD2                                       
REMARK 470     PHE E 202    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 204    CG   CD1  CD2                                       
REMARK 470     PRO E 205    CG   CD                                             
REMARK 470     ARG E 206    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL F  56    CG1  CG2                                            
REMARK 470     HIS F  57    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLN F  58    CG   CD   OE1  NE2                                  
REMARK 470     LEU F  59    CG   CD1  CD2                                       
REMARK 470     VAL F  60    CG1  CG2                                            
REMARK 470     ASP F  61    CG   OD1  OD2                                       
REMARK 470     ILE F  62    CG1  CG2  CD1                                       
REMARK 470     TYR F  63    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLU F  64    CG   CD   OE1  OE2                                  
REMARK 470     LYS F  65    CG   CD   CE   NZ                                   
REMARK 470     TYR F  66    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN F  67    CG   CD   OE1  NE2                                  
REMARK 470     ASP F  68    CG   OD1  OD2                                       
REMARK 470     LEU F  69    CG   CD1  CD2                                       
REMARK 470     TYR F  70    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     THR F  71    OG1  CG2                                            
REMARK 470     VAL F  72    CG1  CG2                                            
REMARK 470     GLU F  73    CG   CD   OE1  OE2                                  
REMARK 470     PRO F  74    CG   CD                                             
REMARK 470     ASN F  75    CG   OD1  ND2                                       
REMARK 470     ASN F  76    CG   OD1  ND2                                       
REMARK 470     GLN F 110    CG   CD   OE1  NE2                                  
REMARK 470     HIS F 113    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLN F 114    CG   CD   OE1  NE2                                  
REMARK 470     TRP F 115    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 115    CZ3  CH2                                            
REMARK 470     ARG F 116    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU F 117    CG   CD   OE1  OE2                                  
REMARK 470     ASP F 118    CG   OD1  OD2                                       
REMARK 470     PHE F 119    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     SER F 121    OG                                                  
REMARK 470     ASN F 122    CG   OD1  ND2                                       
REMARK 470     GLU F 123    CG   CD   OE1  OE2                                  
REMARK 470     VAL F 124    CG1  CG2                                            
REMARK 470     VAL F 125    CG1  CG2                                            
REMARK 470     TYR F 126    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TYR F 127    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASN F 128    CG   OD1  ND2                                       
REMARK 470     LYS F 130    CG   CD   CE   NZ                                   
REMARK 470     ASP F 131    CG   OD1  OD2                                       
REMARK 470     ASP F 132    CG   OD1  OD2                                       
REMARK 470     LEU F 133    CG   CD1  CD2                                       
REMARK 470     ASP F 134    CG   OD1  OD2                                       
REMARK 470     PRO F 135    CG   CD                                             
REMARK 470     GLU F 136    CG   CD   OE1  OE2                                  
REMARK 470     LYS F 137    CG   CD   CE   NZ                                   
REMARK 470     ASN F 138    CG   OD1  ND2                                       
REMARK 470     ASP F 139    CG   OD1  OD2                                       
REMARK 470     SER F 140    OG                                                  
REMARK 470     GLU F 141    CG   CD   OE1  OE2                                  
REMARK 470     PRO F 142    CG   CD                                             
REMARK 470     SER F 144    OG                                                  
REMARK 470     GLN F 145    CG   CD   OE1  NE2                                  
REMARK 470     ARG F 146    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER F 162    OG                                                  
REMARK 470     TYR F 163    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN F 164    CG   CD   OE1  NE2                                  
REMARK 470     HIS F 165    CG   ND1  CD2  CE1  NE2                             
REMARK 470     PRO F 171    CG   CD                                             
REMARK 470     THR F 172    OG1  CG2                                            
REMARK 470     ASP F 173    CG   OD1  OD2                                       
REMARK 470     ILE F 174    CG1  CG2  CD1                                       
REMARK 470     TYR F 175    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLU F 176    CG   CD   OE1  OE2                                  
REMARK 470     ASN F 233    CG   OD1  ND2                                       
REMARK 470     GLU F 476    CG   CD   OE1  OE2                                  
REMARK 470     ASN F 477    CG   OD1  ND2                                       
REMARK 470     LYS F 478    CG   CD   CE   NZ                                   
REMARK 470     LYS F 482    CG   CD   CE   NZ                                   
REMARK 470     GLN F 484    CG   CD   OE1  NE2                                  
REMARK 470     TYR F 513    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TYR F 514    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TYR F 522    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PRO F 553    CG   CD                                             
REMARK 470     TYR F 629    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     SER F 630    OG                                                  
REMARK 470     PHE F 631    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     TYR F 632    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     TYR F 633    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ILE F 634    CG1  CG2  CD1                                       
REMARK 470     LYS F 635    CG   CD   CE   NZ                                   
REMARK 470     LYS F 637    CG   CD   CE   NZ                                   
REMARK 470     ILE F 638    CG1  CG2  CD1                                       
REMARK 470     GLU F 639    CG   CD   OE1  OE2                                  
REMARK 470     GLU F 640    CG   CD   OE1  OE2                                  
REMARK 470     THR F 641    OG1  CG2                                            
REMARK 470     ILE F 642    CG1  CG2  CD1                                       
REMARK 470     THR F 643    OG1  CG2                                            
REMARK 470     GLN F 644    CG   CD   OE1  NE2                                  
REMARK 470     ARG F 646    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     TYR F 647    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     SER F 648    OG                                                  
REMARK 470     GLU F 649    CG   CD   OE1  OE2                                  
REMARK 470     THR F 650    OG1  CG2                                            
REMARK 470     LEU F 651    CG   CD1  CD2                                       
REMARK 470     LYS F 652    CG   CD   CE   NZ                                   
REMARK 470     PRO F 653    CG   CD                                             
REMARK 470     ASP F 654    CG   OD1  OD2                                       
REMARK 470     CYS F 977    SG                                                  
REMARK 470     ILE F 978    CG1  CG2  CD1                                       
REMARK 470     THR F 979    OG1  CG2                                            
REMARK 470     GLU F 980    CG   CD   OE1  OE2                                  
REMARK 470     GLN F 981    CG   CD   OE1  NE2                                  
REMARK 470     THR F 982    OG1  CG2                                            
REMARK 470     GLN F 983    CG   CD   OE1  NE2                                  
REMARK 470     TYR F 984    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE F 985    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     PHE F 986    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP F 987    CG   OD1  OD2                                       
REMARK 470     ASP F 989    CG   OD1  OD2                                       
REMARK 470     LYS F1010    CG   CD   CE   NZ                                   
REMARK 470     ILE F1019    CG1  CG2  CD1                                       
REMARK 470     PRO F1028    CG   CD                                             
REMARK 470     CYS F1029    SG                                                  
REMARK 470     ASP F1030    CG   OD1  OD2                                       
REMARK 470     THR F1031    OG1  CG2                                            
REMARK 470     ARG F1032    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F1033    CG   CD1  CD2                                       
REMARK 470     LEU F1034    CG   CD1  CD2                                       
REMARK 470     ILE F1035    CG1  CG2  CD1                                       
REMARK 470     GLN F1036    CG   CD   OE1  NE2                                  
REMARK 470     GLU F1038    CG   CD   OE1  OE2                                  
REMARK 470     GLN F1039    CG   CD   OE1  NE2                                  
REMARK 470     THR F1040    OG1  CG2                                            
REMARK 470     SER F1041    OG                                                  
REMARK 470     ASP F1042    CG   OD1  OD2                                       
REMARK 470     PRO F1044    CG   CD                                             
REMARK 470     ASP F1045    CG   OD1  OD2                                       
REMARK 470     PRO F1046    CG   CD                                             
REMARK 470     CYS F1047    SG                                                  
REMARK 470     ASP F1048    CG   OD1  OD2                                       
REMARK 470     MET F1049    CG   SD   CE                                        
REMARK 470     VAL F1050    CG1  CG2                                            
REMARK 470     LYS F1051    CG   CD   CE   NZ                                   
REMARK 470     GLN F1052    CG   CD   OE1  NE2                                  
REMARK 470     PRO F1053    CG   CD                                             
REMARK 470     ARG F1054    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     TYR F1055    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ARG F1056    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS F1057    CG   CD   CE   NZ                                   
REMARK 470     PRO F1059    CG   CD                                             
REMARK 470     ASP F1060    CG   OD1  OD2                                       
REMARK 470     VAL F1061    CG1  CG2                                            
REMARK 470     PHE F1063    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP F1064    CG   OD1  OD2                                       
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   CD1  ILE F   499     CD2  LEU F   626              1.42            
REMARK 500   CG1  ILE F   499     CD2  LEU F   626              1.76            
REMARK 500   O    LEU F   626     N    THR F   628              2.02            
REMARK 500   OH   TYR F   335     O    GLU F   369              2.05            
REMARK 500   O    GLY A   365     OG   SER A   368              2.11            
REMARK 500   OG   SER F   263     OG   SER F   265              2.14            
REMARK 500   OG1  THR F   503     OD1  ASN F   511              2.15            
REMARK 500   O    VAL A  1064     OG1  THR A  1067              2.15            
REMARK 500   O    LEU E   200     OG   SER E   203              2.16            
REMARK 500   O    SER A  1006     OG1  THR A  1009              2.16            
REMARK 500   O    GLN A   287     OG1  THR A   290              2.17            
REMARK 500   OG   SER B   290     OG1  THR B   292              2.19            
REMARK 500   O4   NAG F  1203     O7   NAG F  1204              2.19            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500    PRO A  73   N   -  CA  -  CB  ANGL. DEV. =   7.3 DEGREES          
REMARK 500    PRO A 242   N   -  CA  -  CB  ANGL. DEV. =   7.3 DEGREES          
REMARK 500    PRO A 253   N   -  CA  -  CB  ANGL. DEV. =   7.3 DEGREES          
REMARK 500    PRO A 457   N   -  CA  -  CB  ANGL. DEV. =   7.6 DEGREES          
REMARK 500    PRO A 987   N   -  CA  -  CB  ANGL. DEV. =   7.7 DEGREES          
REMARK 500    PRO A1346   N   -  CA  -  CB  ANGL. DEV. =   7.6 DEGREES          
REMARK 500    PRO F 135   N   -  CA  -  CB  ANGL. DEV. =   7.3 DEGREES          
REMARK 500    PRO F 510   C   -  N   -  CA  ANGL. DEV. =  10.9 DEGREES          
REMARK 500    PRO F 553   N   -  CA  -  CB  ANGL. DEV. =   7.2 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    CYS A  33     -174.59     59.09                                   
REMARK 500    THR A  35      -76.99     52.86                                   
REMARK 500    LEU A  36      144.74     65.66                                   
REMARK 500    ASN A  38     -126.43    -83.46                                   
REMARK 500    PRO A  39     -133.60     53.93                                   
REMARK 500    TRP A  50     -105.13    -72.99                                   
REMARK 500    LYS A  51      -51.24   -160.97                                   
REMARK 500    MET A  74     -131.35   -112.88                                   
REMARK 500    PRO A  75      -95.61   -164.21                                   
REMARK 500    ASP A  77     -116.04     64.65                                   
REMARK 500    ASP A  78     -123.36    -75.06                                   
REMARK 500    ASN A  79      -90.23     55.03                                   
REMARK 500    ASN A  80      162.93     62.99                                   
REMARK 500    SER A  81     -105.27   -142.89                                   
REMARK 500    ALA A 107     -105.30    -72.64                                   
REMARK 500    PHE A 131      -77.91    -55.00                                   
REMARK 500    SER A 181      -34.53     84.71                                   
REMARK 500    LEU A 196      -21.31   -166.41                                   
REMARK 500    GLU A 216      -83.26   -124.51                                   
REMARK 500    ASP A 232     -158.17     55.10                                   
REMARK 500    VAL A 234       70.22    -64.50                                   
REMARK 500    GLU A 240       56.53   -154.19                                   
REMARK 500    LYS A 241      137.06     64.96                                   
REMARK 500    THR A 248      -87.36    -52.96                                   
REMARK 500    ARG A 252      126.44     66.09                                   
REMARK 500    PRO A 253      -35.43   -159.04                                   
REMARK 500    CYS A 254       85.98     51.34                                   
REMARK 500    ILE A 256      -40.36   -141.47                                   
REMARK 500    SER A 259     -142.38     53.75                                   
REMARK 500    CYS A 261      147.79     64.31                                   
REMARK 500    ARG A 262     -133.32    -72.82                                   
REMARK 500    PRO A 266        2.99   -156.49                                   
REMARK 500    PRO A 268      -42.13   -153.80                                   
REMARK 500    THR A 273       -6.89   -176.95                                   
REMARK 500    ASP A 276      -81.85    -49.59                                   
REMARK 500    ILE A 305      100.06     31.40                                   
REMARK 500    GLU A 308     -104.86    -82.76                                   
REMARK 500    TRP A 436     -152.84   -140.77                                   
REMARK 500    LEU A 463     -108.87    -93.46                                   
REMARK 500    ASN A 468       97.38     55.01                                   
REMARK 500    SER A 473       14.24   -152.78                                   
REMARK 500    PHE A 496       11.81   -162.57                                   
REMARK 500    ASN A 497     -120.63     54.35                                   
REMARK 500    ALA A 518     -122.82    -71.01                                   
REMARK 500    LEU A 522     -138.93   -127.01                                   
REMARK 500    TYR A 541     -145.36    -74.22                                   
REMARK 500    TRP A 542       80.30     54.22                                   
REMARK 500    SER A 544      -29.88     69.06                                   
REMARK 500    LEU A 580      -86.24   -104.28                                   
REMARK 500    TYR A 585      -51.43     60.74                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS     301 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 610                                                                      
REMARK 610 MISSING HETEROATOM                                                   
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 610 I=INSERTION CODE):                                                   
REMARK 610   M RES C SSEQI                                                      
REMARK 610     NAG F 1201                                                       
REMARK 610     NAG F 1202                                                       
REMARK 610     NAG F 1203                                                       
REMARK 610     NAG F 1204                                                       
REMARK 610     NAG F 1205                                                       
REMARK 610     NAG F 1206                                                       
REMARK 610     NAG F 1207                                                       
REMARK 610     NAG F 1208                                                       
REMARK 610     NAG F 1209                                                       
REMARK 610     NAG F 1210                                                       
REMARK 610     NAG F 1211                                                       
REMARK 610     NAG F 1212                                                       
REMARK 610     NAG F 1213                                                       
REMARK 610     NAG F 1214                                                       
REMARK 610     NAG F 1215                                                       
REMARK 610     BMA F 1216                                                       
REMARK 610     BMA F 1217                                                       
REMARK 800                                                                      
REMARK 800 SITE                                                                 
REMARK 800 SITE_IDENTIFIER: AC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CA A 1901                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1201                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1202                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1203                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1204                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1205                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1206                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1207                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1208                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1209                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1210                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1211                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1212                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1213                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1214                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG F 1215                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BMA F 1216                
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BMA F 1217                
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-6475   RELATED DB: EMDB                              
REMARK 900 RELATED ID: EMD-6476   RELATED DB: EMDB                              
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 RESIDUES 1396-1520 OF ENTITY 1 (CHAIN A), AND RESIDUES 40-55/662-    
REMARK 999 955 OF ENTITY 4 (CHAIN F) ARE MODELED AS UNK SINCE THE EM DENSITY    
REMARK 999 IS NOT GOOD ENOUGH TO ASSIGN EXACTLY. THE REAL SEQUENCE OF RESIDUES  
REMARK 999 1396-1520 OF ENTITY 1 (CHAIN A) SHOULD BE                            
REMARK 999 (PHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVT 
REMARK 999  FNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTV). REAL   
REMARK 999  SEQUENCES FOR RESIDUES 40-55/662-955 OF ENTITY 4 SHOULD BE          
REMARK 999  (DMQEDLVTLAKTASG) AND                                               
REMARK 999  (TFLAPRDYCSDLKPSDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRVLLDAGFTNELVQNYWSKQK 
REMARK 999  NIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESG 
REMARK 999  IMVSKAVEIYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVILDDGGF 
REMARK 999  LLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDYQSVCEPGAAPKQGAGHRSAYVPSIA 
REMARK 999  DILQIGWWATAAAWSILQQFLLSLTFP) RESPECTIVELY.                          
DBREF  3JBR A    1  1395  UNP    P07293   CAC1S_RABIT      1   1395             
DBREF  3JBR A 1396  1520  PDB    3JBR     3JBR          1396   1520             
DBREF  3JBR A 1521  1873  UNP    P07293   CAC1S_RABIT   1521   1873             
DBREF  3JBR B   17   200  UNP    Q8VGC3   CACB2_RAT       68    196             
DBREF  3JBR B  202   424  UNP    Q8VGC3   CACB2_RAT      254    475             
DBREF  3JBR E    1   222  UNP    P19518   CCG1_RABIT       1    222             
DBREF  3JBR F    1    39  UNP    P13806   CA2D1_RABIT      1     39             
DBREF  3JBR F   40    55  PDB    3JBR     3JBR            40     55             
DBREF  3JBR F   56   661  UNP    P13806   CA2D1_RABIT     56    661             
DBREF  3JBR F  662   955  PDB    3JBR     3JBR           662    955             
DBREF  3JBR F  956  1106  UNP    P13806   CA2D1_RABIT    956   1106             
SEQADV 3JBR GLY B   14  UNP  Q8VGC3              EXPRESSION TAG                 
SEQADV 3JBR HIS B   15  UNP  Q8VGC3              EXPRESSION TAG                 
SEQADV 3JBR MET B   16  UNP  Q8VGC3              EXPRESSION TAG                 
SEQADV 3JBR MET B  201  UNP  Q8VGC3              LINKER                         
SEQRES   1 A 1873  MET GLU PRO SER SER PRO GLN ASP GLU GLY LEU ARG LYS          
SEQRES   2 A 1873  LYS GLN PRO LYS LYS PRO LEU PRO GLU VAL LEU PRO ARG          
SEQRES   3 A 1873  PRO PRO ARG ALA LEU PHE CYS LEU THR LEU GLN ASN PRO          
SEQRES   4 A 1873  LEU ARG LYS ALA CYS ILE SER ILE VAL GLU TRP LYS PRO          
SEQRES   5 A 1873  PHE GLU THR ILE ILE LEU LEU THR ILE PHE ALA ASN CYS          
SEQRES   6 A 1873  VAL ALA LEU ALA VAL TYR LEU PRO MET PRO GLU ASP ASP          
SEQRES   7 A 1873  ASN ASN SER LEU ASN LEU GLY LEU GLU LYS LEU GLU TYR          
SEQRES   8 A 1873  PHE PHE LEU THR VAL PHE SER ILE GLU ALA ALA MET LYS          
SEQRES   9 A 1873  ILE ILE ALA TYR GLY PHE LEU PHE HIS GLN ASP ALA TYR          
SEQRES  10 A 1873  LEU ARG SER GLY TRP ASN VAL LEU ASP PHE ILE ILE VAL          
SEQRES  11 A 1873  PHE LEU GLY VAL PHE THR ALA ILE LEU GLU GLN VAL ASN          
SEQRES  12 A 1873  VAL ILE GLN SER ASN THR ALA PRO MET SER SER LYS GLY          
SEQRES  13 A 1873  ALA GLY LEU ASP VAL LYS ALA LEU ARG ALA PHE ARG VAL          
SEQRES  14 A 1873  LEU ARG PRO LEU ARG LEU VAL SER GLY VAL PRO SER LEU          
SEQRES  15 A 1873  GLN VAL VAL LEU ASN SER ILE PHE LYS ALA MET LEU PRO          
SEQRES  16 A 1873  LEU PHE HIS ILE ALA LEU LEU VAL LEU PHE MET VAL ILE          
SEQRES  17 A 1873  ILE TYR ALA ILE ILE GLY LEU GLU LEU PHE LYS GLY LYS          
SEQRES  18 A 1873  MET HIS LYS THR CYS TYR TYR ILE GLY THR ASP ILE VAL          
SEQRES  19 A 1873  ALA THR VAL GLU ASN GLU LYS PRO SER PRO CYS ALA ARG          
SEQRES  20 A 1873  THR GLY SER GLY ARG PRO CYS THR ILE ASN GLY SER GLU          
SEQRES  21 A 1873  CYS ARG GLY GLY TRP PRO GLY PRO ASN HIS GLY ILE THR          
SEQRES  22 A 1873  HIS PHE ASP ASN PHE GLY PHE SER MET LEU THR VAL TYR          
SEQRES  23 A 1873  GLN CYS ILE THR MET GLU GLY TRP THR ASP VAL LEU TYR          
SEQRES  24 A 1873  TRP VAL ASN ASP ALA ILE GLY ASN GLU TRP PRO TRP ILE          
SEQRES  25 A 1873  TYR PHE VAL THR LEU ILE LEU LEU GLY SER PHE PHE ILE          
SEQRES  26 A 1873  LEU ASN LEU VAL LEU GLY VAL LEU SER GLY GLU PHE THR          
SEQRES  27 A 1873  LYS GLU ARG GLU LYS ALA LYS SER ARG GLY THR PHE GLN          
SEQRES  28 A 1873  LYS LEU ARG GLU LYS GLN GLN LEU GLU GLU ASP LEU ARG          
SEQRES  29 A 1873  GLY TYR MET SER TRP ILE THR GLN GLY GLU VAL MET ASP          
SEQRES  30 A 1873  VAL GLU ASP LEU ARG GLU GLY LYS LEU SER LEU GLU GLU          
SEQRES  31 A 1873  GLY GLY SER ASP THR GLU SER LEU TYR GLU ILE GLU GLY          
SEQRES  32 A 1873  LEU ASN LYS ILE ILE GLN PHE ILE ARG HIS TRP ARG GLN          
SEQRES  33 A 1873  TRP ASN ARG VAL PHE ARG TRP LYS CYS HIS ASP LEU VAL          
SEQRES  34 A 1873  LYS SER ARG VAL PHE TYR TRP LEU VAL ILE LEU ILE VAL          
SEQRES  35 A 1873  ALA LEU ASN THR LEU SER ILE ALA SER GLU HIS HIS ASN          
SEQRES  36 A 1873  GLN PRO LEU TRP LEU THR HIS LEU GLN ASP ILE ALA ASN          
SEQRES  37 A 1873  ARG VAL LEU LEU SER LEU PHE THR ILE GLU MET LEU LEU          
SEQRES  38 A 1873  LYS MET TYR GLY LEU GLY LEU ARG GLN TYR PHE MET SER          
SEQRES  39 A 1873  ILE PHE ASN ARG PHE ASP CYS PHE VAL VAL CYS SER GLY          
SEQRES  40 A 1873  ILE LEU GLU LEU LEU LEU VAL GLU SER GLY ALA MET THR          
SEQRES  41 A 1873  PRO LEU GLY ILE SER VAL LEU ARG CYS ILE ARG LEU LEU          
SEQRES  42 A 1873  ARG LEU PHE LYS ILE THR LYS TYR TRP THR SER LEU SER          
SEQRES  43 A 1873  ASN LEU VAL ALA SER LEU LEU ASN SER ILE ARG SER ILE          
SEQRES  44 A 1873  ALA SER LEU LEU LEU LEU LEU PHE LEU PHE ILE ILE ILE          
SEQRES  45 A 1873  PHE ALA LEU LEU GLY MET GLN LEU PHE GLY GLY ARG TYR          
SEQRES  46 A 1873  ASP PHE GLU ASP THR GLU VAL ARG ARG SER ASN PHE ASP          
SEQRES  47 A 1873  ASN PHE PRO GLN ALA LEU ILE SER VAL PHE GLN VAL LEU          
SEQRES  48 A 1873  THR GLY GLU ASP TRP ASN SER VAL MET TYR ASN GLY ILE          
SEQRES  49 A 1873  MET ALA TYR GLY GLY PRO SER TYR PRO GLY VAL LEU VAL          
SEQRES  50 A 1873  CYS ILE TYR PHE ILE ILE LEU PHE VAL CYS GLY ASN TYR          
SEQRES  51 A 1873  ILE LEU LEU ASN VAL PHE LEU ALA ILE ALA VAL ASP ASN          
SEQRES  52 A 1873  LEU ALA GLU ALA GLU SER LEU THR SER ALA GLN LYS ALA          
SEQRES  53 A 1873  LYS ALA GLU GLU ARG LYS ARG ARG LYS MET SER ARG GLY          
SEQRES  54 A 1873  LEU PRO ASP LYS THR GLU GLU GLU LYS SER VAL MET ALA          
SEQRES  55 A 1873  LYS LYS LEU GLU GLN LYS PRO LYS GLY GLU GLY ILE PRO          
SEQRES  56 A 1873  THR THR ALA LYS LEU LYS VAL ASP GLU PHE GLU SER ASN          
SEQRES  57 A 1873  VAL ASN GLU VAL LYS ASP PRO TYR PRO SER ALA ASP PHE          
SEQRES  58 A 1873  PRO GLY ASP ASP GLU GLU ASP GLU PRO GLU ILE PRO VAL          
SEQRES  59 A 1873  SER PRO ARG PRO ARG PRO LEU ALA GLU LEU GLN LEU LYS          
SEQRES  60 A 1873  GLU LYS ALA VAL PRO ILE PRO GLU ALA SER SER PHE PHE          
SEQRES  61 A 1873  ILE PHE SER PRO THR ASN LYS VAL ARG VAL LEU CYS HIS          
SEQRES  62 A 1873  ARG ILE VAL ASN ALA THR TRP PHE THR ASN PHE ILE LEU          
SEQRES  63 A 1873  LEU PHE ILE LEU LEU SER SER ALA ALA LEU ALA ALA GLU          
SEQRES  64 A 1873  ASP PRO ILE ARG ALA GLU SER VAL ARG ASN GLN ILE LEU          
SEQRES  65 A 1873  GLY TYR PHE ASP ILE ALA PHE THR SER VAL PHE THR VAL          
SEQRES  66 A 1873  GLU ILE VAL LEU LYS MET THR THR TYR GLY ALA PHE LEU          
SEQRES  67 A 1873  HIS LYS GLY SER PHE CYS ARG ASN TYR PHE ASN ILE LEU          
SEQRES  68 A 1873  ASP LEU LEU VAL VAL ALA VAL SER LEU ILE SER MET GLY          
SEQRES  69 A 1873  LEU GLU SER SER THR ILE SER VAL VAL LYS ILE LEU ARG          
SEQRES  70 A 1873  VAL LEU ARG VAL LEU ARG PRO LEU ARG ALA ILE ASN ARG          
SEQRES  71 A 1873  ALA LYS GLY LEU LYS HIS VAL VAL GLN CYS VAL PHE VAL          
SEQRES  72 A 1873  ALA ILE ARG THR ILE GLY ASN ILE VAL LEU VAL THR THR          
SEQRES  73 A 1873  LEU LEU GLN PHE MET PHE ALA CYS ILE GLY VAL GLN LEU          
SEQRES  74 A 1873  PHE LYS GLY LYS PHE PHE SER CYS ASN ASP LEU SER LYS          
SEQRES  75 A 1873  MET THR GLU GLU GLU CYS ARG GLY TYR TYR TYR VAL TYR          
SEQRES  76 A 1873  LYS ASP GLY ASP PRO THR GLN MET GLU LEU ARG PRO ARG          
SEQRES  77 A 1873  GLN TRP ILE HIS ASN ASP PHE HIS PHE ASP ASN VAL LEU          
SEQRES  78 A 1873  SER ALA MET MET SER LEU PHE THR VAL SER THR PHE GLU          
SEQRES  79 A 1873  GLY TRP PRO GLN LEU LEU TYR ARG ALA ILE ASP SER ASN          
SEQRES  80 A 1873  GLU GLU ASP MET GLY PRO VAL TYR ASN ASN ARG VAL GLU          
SEQRES  81 A 1873  MET ALA ILE PHE PHE ILE ILE TYR ILE ILE LEU ILE ALA          
SEQRES  82 A 1873  PHE PHE MET MET ASN ILE PHE VAL GLY PHE VAL ILE VAL          
SEQRES  83 A 1873  THR PHE GLN GLU GLN GLY GLU THR GLU TYR LYS ASN CYS          
SEQRES  84 A 1873  GLU LEU ASP LYS ASN GLN ARG GLN CYS VAL GLN TYR ALA          
SEQRES  85 A 1873  LEU LYS ALA ARG PRO LEU ARG CYS TYR ILE PRO LYS ASN          
SEQRES  86 A 1873  PRO TYR GLN TYR GLN VAL TRP TYR VAL VAL THR SER SER          
SEQRES  87 A 1873  TYR PHE GLU TYR LEU MET PHE ALA LEU ILE MET LEU ASN          
SEQRES  88 A 1873  THR ILE CYS LEU GLY MET GLN HIS TYR HIS GLN SER GLU          
SEQRES  89 A 1873  GLU MET ASN HIS ILE SER ASP ILE LEU ASN VAL ALA PHE          
SEQRES  90 A 1873  THR ILE ILE PHE THR LEU GLU MET ILE LEU LYS LEU LEU          
SEQRES  91 A 1873  ALA PHE LYS ALA ARG GLY TYR PHE GLY ASP PRO TRP ASN          
SEQRES  92 A 1873  VAL PHE ASP PHE LEU ILE VAL ILE GLY SER ILE ILE ASP          
SEQRES  93 A 1873  VAL ILE LEU SER GLU ILE ASP THR PHE LEU ALA SER SER          
SEQRES  94 A 1873  GLY GLY LEU TYR CYS LEU GLY GLY GLY CYS GLY ASN VAL          
SEQRES  95 A 1873  ASP PRO ASP GLU SER ALA ARG ILE SER SER ALA PHE PHE          
SEQRES  96 A 1873  ARG LEU PHE ARG VAL MET ARG LEU ILE LYS LEU LEU SER          
SEQRES  97 A 1873  ARG ALA GLU GLY VAL ARG THR LEU LEU TRP THR PHE ILE          
SEQRES  98 A 1873  LYS SER PHE GLN ALA LEU PRO TYR VAL ALA LEU LEU ILE          
SEQRES  99 A 1873  VAL MET LEU PHE PHE ILE TYR ALA VAL ILE GLY MET GLN          
SEQRES 100 A 1873  MET PHE GLY LYS ILE ALA LEU VAL ASP GLY THR GLN ILE          
SEQRES 101 A 1873  ASN ARG ASN ASN ASN PHE GLN THR PHE PRO GLN ALA VAL          
SEQRES 102 A 1873  LEU LEU LEU PHE ARG CYS ALA THR GLY GLU ALA TRP GLN          
SEQRES 103 A 1873  GLU ILE LEU LEU ALA CYS SER TYR GLY LYS LEU CYS ASP          
SEQRES 104 A 1873  PRO GLU SER ASP TYR ALA PRO GLY GLU GLU TYR THR CYS          
SEQRES 105 A 1873  GLY THR ASN PHE ALA TYR TYR TYR PHE ILE SER PHE TYR          
SEQRES 106 A 1873  MET LEU CYS ALA PHE LEU ILE ILE ASN LEU PHE VAL ALA          
SEQRES 107 A 1873  VAL ILE MET ASP ASN PHE ASP TYR LEU THR ARG ASP TRP          
SEQRES 108 A 1873  SER ILE LEU GLY UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 109 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 110 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 111 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 112 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 113 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 114 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 115 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 116 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 117 A 1873  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK GLY          
SEQRES 118 A 1873  LYS PHE TYR ALA THR PHE LEU ILE GLN GLU HIS PHE ARG          
SEQRES 119 A 1873  LYS PHE MET LYS ARG GLN GLU GLU TYR TYR GLY TYR ARG          
SEQRES 120 A 1873  PRO LYS LYS ASP THR VAL GLN ILE GLN ALA GLY LEU ARG          
SEQRES 121 A 1873  THR ILE GLU GLU GLU ALA ALA PRO GLU ILE ARG ARG THR          
SEQRES 122 A 1873  ILE SER GLY ASP LEU THR ALA GLU GLU GLU LEU GLU ARG          
SEQRES 123 A 1873  ALA MET VAL GLU ALA ALA MET GLU GLU ARG ILE PHE ARG          
SEQRES 124 A 1873  ARG THR GLY GLY LEU PHE GLY GLN VAL ASP THR PHE LEU          
SEQRES 125 A 1873  GLU ARG THR ASN SER LEU PRO PRO VAL MET ALA ASN GLN          
SEQRES 126 A 1873  ARG PRO LEU GLN PHE ALA GLU ILE GLU MET GLU GLU LEU          
SEQRES 127 A 1873  GLU SER PRO VAL PHE LEU GLU ASP PHE PRO GLN ASP ALA          
SEQRES 128 A 1873  ARG THR ASN PRO LEU ALA ARG ALA ASN THR ASN ASN ALA          
SEQRES 129 A 1873  ASN ALA ASN VAL ALA TYR GLY ASN SER ASN HIS SER ASN          
SEQRES 130 A 1873  ASN GLN MET PHE SER SER VAL HIS CYS GLU ARG GLU PHE          
SEQRES 131 A 1873  PRO GLY GLU ALA GLU THR PRO ALA ALA GLY ARG GLY ALA          
SEQRES 132 A 1873  LEU SER HIS SER HIS ARG ALA LEU GLY PRO HIS SER LYS          
SEQRES 133 A 1873  PRO CYS ALA GLY LYS LEU ASN GLY GLN LEU VAL GLN PRO          
SEQRES 134 A 1873  GLY MET PRO ILE ASN GLN ALA PRO PRO ALA PRO CYS GLN          
SEQRES 135 A 1873  GLN PRO SER THR ASP PRO PRO GLU ARG GLY GLN ARG ARG          
SEQRES 136 A 1873  THR SER LEU THR GLY SER LEU GLN ASP GLU ALA PRO GLN          
SEQRES 137 A 1873  ARG ARG SER SER GLU GLY SER THR PRO ARG ARG PRO ALA          
SEQRES 138 A 1873  PRO ALA THR ALA LEU LEU ILE GLN GLU ALA LEU VAL ARG          
SEQRES 139 A 1873  GLY GLY LEU ASP THR LEU ALA ALA ASP ALA GLY PHE VAL          
SEQRES 140 A 1873  THR ALA THR SER GLN ALA LEU ALA ASP ALA CYS GLN MET          
SEQRES 141 A 1873  GLU PRO GLU GLU VAL GLU VAL ALA ALA THR GLU LEU LEU          
SEQRES 142 A 1873  LYS ALA ARG GLU SER VAL GLN GLY MET ALA SER VAL PRO          
SEQRES 143 A 1873  GLY SER LEU SER ARG ARG SER SER LEU GLY SER LEU ASP          
SEQRES 144 A 1873  GLN VAL GLN GLY SER GLN GLU THR LEU ILE PRO PRO ARG          
SEQRES 145 A 1873  PRO                                                          
SEQRES   1 B  356  GLY HIS MET GLY SER ALA ASP SER TYR THR SER ARG PRO          
SEQRES   2 B  356  SER ASP SER ASP VAL SER LEU GLU GLU ASP ARG GLU ALA          
SEQRES   3 B  356  VAL ARG ARG GLU ALA GLU ARG GLN ALA GLN ALA GLN LEU          
SEQRES   4 B  356  GLU LYS ALA LYS THR LYS PRO VAL ALA PHE ALA VAL ARG          
SEQRES   5 B  356  THR ASN VAL ARG TYR SER ALA ALA GLN GLU ASP ASP VAL          
SEQRES   6 B  356  PRO VAL PRO GLY MET ALA ILE SER PHE GLU ALA LYS ASP          
SEQRES   7 B  356  PHE LEU HIS VAL LYS GLU LYS PHE ASN ASN ASP TRP TRP          
SEQRES   8 B  356  ILE GLY ARG LEU VAL LYS GLU GLY CYS GLU ILE GLY PHE          
SEQRES   9 B  356  ILE PRO SER PRO VAL LYS LEU GLU ASN MET ARG LEU GLN          
SEQRES  10 B  356  HIS GLU GLN ARG ALA LYS GLN GLY LYS PHE TYR SER SER          
SEQRES  11 B  356  LYS SER MET SER LYS GLU LYS ARG MET PRO PHE PHE LYS          
SEQRES  12 B  356  LYS THR GLU HIS THR PRO PRO TYR ASP VAL VAL PRO SER          
SEQRES  13 B  356  MET ARG PRO VAL VAL LEU VAL GLY PRO SER LEU LYS GLY          
SEQRES  14 B  356  TYR GLU VAL THR ASP MET MET GLN LYS ALA LEU PHE ASP          
SEQRES  15 B  356  PHE LEU LYS HIS ARG PHE GLU GLY ARG ILE SER ILE THR          
SEQRES  16 B  356  ARG VAL THR ALA ASP ILE SER LEU ALA LYS ARG SER VAL          
SEQRES  17 B  356  LEU ASN ASN PRO SER LYS HIS ALA ILE ILE GLU ARG SER          
SEQRES  18 B  356  ASN THR ARG SER SER LEU ALA GLU VAL GLN SER GLU ILE          
SEQRES  19 B  356  GLU ARG ILE PHE GLU LEU ALA ARG THR LEU GLN LEU VAL          
SEQRES  20 B  356  VAL LEU ASP ALA ASP THR ILE ASN HIS PRO ALA GLN LEU          
SEQRES  21 B  356  SER LYS THR SER LEU ALA PRO ILE ILE VAL TYR VAL LYS          
SEQRES  22 B  356  ILE SER SER PRO LYS VAL LEU GLN ARG LEU ILE LYS SER          
SEQRES  23 B  356  ARG GLY LYS SER GLN ALA LYS HIS LEU ASN VAL GLN MET          
SEQRES  24 B  356  VAL ALA ALA ASP LYS LEU ALA GLN CYS PRO PRO GLN GLU          
SEQRES  25 B  356  SER PHE ASP VAL ILE LEU ASP GLU ASN GLN LEU GLU ASP          
SEQRES  26 B  356  ALA CYS GLU HIS LEU ALA ASP TYR LEU GLU ALA TYR TRP          
SEQRES  27 B  356  LYS ALA THR HIS PRO PRO SER SER ASN LEU PRO ASN PRO          
SEQRES  28 B  356  LEU LEU SER ARG THR                                          
SEQRES   1 E  222  MET SER PRO THR GLU ALA PRO LYS VAL ARG VAL THR LEU          
SEQRES   2 E  222  PHE CYS ILE LEU VAL GLY ILE VAL LEU ALA MET THR ALA          
SEQRES   3 E  222  VAL VAL SER ASP HIS TRP ALA VAL LEU SER PRO HIS MET          
SEQRES   4 E  222  GLU ASN HIS ASN THR THR CYS GLU ALA ALA HIS PHE GLY          
SEQRES   5 E  222  LEU TRP ARG ILE CYS THR LYS ARG ILE ALA LEU GLY GLU          
SEQRES   6 E  222  ASP ARG SER CYS GLY PRO ILE THR LEU PRO GLY GLU LYS          
SEQRES   7 E  222  ASN CYS SER TYR PHE ARG HIS PHE ASN PRO GLY GLU SER          
SEQRES   8 E  222  SER GLU ILE PHE GLU PHE THR THR GLN LYS GLU TYR SER          
SEQRES   9 E  222  ILE SER ALA ALA ALA ILE SER VAL PHE SER LEU GLY PHE          
SEQRES  10 E  222  LEU ILE MET GLY THR ILE CYS ALA LEU MET ALA PHE ARG          
SEQRES  11 E  222  LYS LYS ARG ASP TYR LEU LEU ARG PRO ALA SER MET PHE          
SEQRES  12 E  222  TYR VAL PHE ALA GLY LEU CYS LEU PHE VAL SER LEU GLU          
SEQRES  13 E  222  VAL MET ARG GLN SER VAL LYS ARG MET ILE ASP SER GLU          
SEQRES  14 E  222  ASP THR VAL TRP ILE GLU TYR TYR TYR SER TRP SER PHE          
SEQRES  15 E  222  ALA CYS ALA CYS ALA ALA PHE VAL LEU LEU PHE LEU GLY          
SEQRES  16 E  222  GLY ILE SER LEU LEU LEU PHE SER LEU PRO ARG MET PRO          
SEQRES  17 E  222  GLN ASN PRO TRP GLU SER CYS MET ASP ALA GLU PRO GLU          
SEQRES  18 E  222  HIS                                                          
SEQRES   1 F 1106  MET ALA ALA GLY ARG PRO LEU ALA TRP THR LEU THR LEU          
SEQRES   2 F 1106  TRP GLN ALA TRP LEU ILE LEU ILE GLY PRO SER SER GLU          
SEQRES   3 F 1106  GLU PRO PHE PRO SER ALA VAL THR ILE LYS SER TRP VAL          
SEQRES   4 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   5 F 1106  UNK UNK UNK VAL HIS GLN LEU VAL ASP ILE TYR GLU LYS          
SEQRES   6 F 1106  TYR GLN ASP LEU TYR THR VAL GLU PRO ASN ASN ALA ARG          
SEQRES   7 F 1106  GLN LEU VAL GLU ILE ALA ALA ARG ASP ILE GLU LYS LEU          
SEQRES   8 F 1106  LEU SER ASN ARG SER LYS ALA LEU VAL ARG LEU ALA LEU          
SEQRES   9 F 1106  GLU ALA GLU LYS VAL GLN ALA ALA HIS GLN TRP ARG GLU          
SEQRES  10 F 1106  ASP PHE ALA SER ASN GLU VAL VAL TYR TYR ASN ALA LYS          
SEQRES  11 F 1106  ASP ASP LEU ASP PRO GLU LYS ASN ASP SER GLU PRO GLY          
SEQRES  12 F 1106  SER GLN ARG ILE LYS PRO VAL PHE ILE ASP ASP ALA ASN          
SEQRES  13 F 1106  PHE ARG ARG GLN VAL SER TYR GLN HIS ALA ALA VAL HIS          
SEQRES  14 F 1106  ILE PRO THR ASP ILE TYR GLU GLY SER THR ILE VAL LEU          
SEQRES  15 F 1106  ASN GLU LEU ASN TRP THR SER ALA LEU ASP ASP VAL PHE          
SEQRES  16 F 1106  LYS LYS ASN ARG GLU GLU ASP PRO SER LEU LEU TRP GLN          
SEQRES  17 F 1106  VAL PHE GLY SER ALA THR GLY LEU ALA ARG TYR TYR PRO          
SEQRES  18 F 1106  ALA SER PRO TRP VAL ASP ASN SER ARG THR PRO ASN LYS          
SEQRES  19 F 1106  ILE ASP LEU TYR ASP VAL ARG ARG ARG PRO TRP TYR ILE          
SEQRES  20 F 1106  GLN GLY ALA ALA SER PRO LYS ASP MET LEU ILE LEU VAL          
SEQRES  21 F 1106  ASP VAL SER GLY SER VAL SER GLY LEU THR LEU LYS LEU          
SEQRES  22 F 1106  ILE ARG THR SER VAL SER GLU MET LEU GLU THR LEU SER          
SEQRES  23 F 1106  ASP ASP ASP PHE VAL ASN VAL ALA SER PHE ASN SER ASN          
SEQRES  24 F 1106  ALA GLN ASP VAL SER CYS PHE GLN HIS LEU VAL GLN ALA          
SEQRES  25 F 1106  ASN VAL ARG ASN LYS LYS VAL LEU LYS ASP ALA VAL ASN          
SEQRES  26 F 1106  ASN ILE THR ALA LYS GLY ILE THR ASP TYR LYS LYS GLY          
SEQRES  27 F 1106  PHE SER PHE ALA PHE GLU GLN LEU LEU ASN TYR ASN VAL          
SEQRES  28 F 1106  SER ARG ALA ASN CYS ASN LYS ILE ILE MET LEU PHE THR          
SEQRES  29 F 1106  ASP GLY GLY GLU GLU ARG ALA GLN GLU ILE PHE ALA LYS          
SEQRES  30 F 1106  TYR ASN LYS ASP LYS LYS VAL ARG VAL PHE THR PHE SER          
SEQRES  31 F 1106  VAL GLY GLN HIS ASN TYR ASP ARG GLY PRO ILE GLN TRP          
SEQRES  32 F 1106  MET ALA CYS GLU ASN LYS GLY TYR TYR TYR GLU ILE PRO          
SEQRES  33 F 1106  SER ILE GLY ALA ILE ARG ILE ASN THR GLN GLU TYR LEU          
SEQRES  34 F 1106  ASP VAL LEU GLY ARG PRO MET VAL LEU ALA GLY ASP LYS          
SEQRES  35 F 1106  ALA LYS GLN VAL GLN TRP THR ASN VAL TYR LEU ASP ALA          
SEQRES  36 F 1106  LEU GLU LEU GLY LEU VAL ILE THR GLY THR LEU PRO VAL          
SEQRES  37 F 1106  PHE ASN ILE THR GLY GLN PHE GLU ASN LYS THR ASN LEU          
SEQRES  38 F 1106  LYS ASN GLN LEU ILE LEU GLY VAL MET GLY VAL ASP VAL          
SEQRES  39 F 1106  SER LEU GLU ASP ILE LYS ARG LEU THR PRO ARG PHE THR          
SEQRES  40 F 1106  LEU CYS PRO ASN GLY TYR TYR PHE ALA ILE ASP PRO ASN          
SEQRES  41 F 1106  GLY TYR VAL LEU LEU HIS PRO ASN LEU GLN PRO LYS PRO          
SEQRES  42 F 1106  ILE GLY VAL GLY ILE PRO THR ILE ASN LEU ARG LYS ARG          
SEQRES  43 F 1106  ARG PRO ASN VAL GLN ASN PRO LYS SER GLN GLU PRO VAL          
SEQRES  44 F 1106  THR LEU ASP PHE LEU ASP ALA GLU LEU GLU ASN ASP ILE          
SEQRES  45 F 1106  LYS VAL GLU ILE ARG ASN LYS MET ILE ASP GLY GLU SER          
SEQRES  46 F 1106  GLY GLU LYS THR PHE ARG THR LEU VAL LYS SER GLN ASP          
SEQRES  47 F 1106  GLU ARG TYR ILE ASP LYS GLY ASN ARG THR TYR THR TRP          
SEQRES  48 F 1106  THR PRO VAL ASN GLY THR ASP TYR SER SER LEU ALA LEU          
SEQRES  49 F 1106  VAL LEU PRO THR TYR SER PHE TYR TYR ILE LYS ALA LYS          
SEQRES  50 F 1106  ILE GLU GLU THR ILE THR GLN ALA ARG TYR SER GLU THR          
SEQRES  51 F 1106  LEU LYS PRO ASP ASN PHE GLU GLU SER GLY TYR UNK UNK          
SEQRES  52 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  53 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  54 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  55 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  56 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  57 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  58 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  59 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  60 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  61 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  62 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  63 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  64 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  65 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  66 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  67 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  68 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  69 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  70 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  71 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  72 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  73 F 1106  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  74 F 1106  UNK UNK UNK UNK UNK UNK ARG LEU LEU GLU ALA ALA ASP          
SEQRES  75 F 1106  MET GLU ASP ASP ASP PHE THR ALA SER MET SER LYS GLN          
SEQRES  76 F 1106  SER CYS ILE THR GLU GLN THR GLN TYR PHE PHE ASP ASN          
SEQRES  77 F 1106  ASP SER LYS SER PHE SER GLY VAL LEU ASP CYS GLY ASN          
SEQRES  78 F 1106  CYS SER ARG ILE PHE HIS VAL GLU LYS LEU MET ASN THR          
SEQRES  79 F 1106  ASN LEU ILE PHE ILE MET VAL GLU SER LYS GLY THR CYS          
SEQRES  80 F 1106  PRO CYS ASP THR ARG LEU LEU ILE GLN ALA GLU GLN THR          
SEQRES  81 F 1106  SER ASP GLY PRO ASP PRO CYS ASP MET VAL LYS GLN PRO          
SEQRES  82 F 1106  ARG TYR ARG LYS GLY PRO ASP VAL CYS PHE ASP ASN ASN          
SEQRES  83 F 1106  VAL LEU GLU ASP TYR THR ASP CYS GLY GLY VAL SER GLY          
SEQRES  84 F 1106  LEU ASN PRO SER LEU TRP SER ILE ILE GLY ILE GLN PHE          
SEQRES  85 F 1106  VAL LEU LEU TRP LEU VAL SER GLY SER ARG HIS CYS LEU          
SEQRES  86 F 1106  LEU                                                          
HET     CA  A1901       1                                                       
HET    NAG  F1201      14                                                       
HET    NAG  F1202      14                                                       
HET    NAG  F1203      14                                                       
HET    NAG  F1204      14                                                       
HET    NAG  F1205      14                                                       
HET    NAG  F1206      14                                                       
HET    NAG  F1207      14                                                       
HET    NAG  F1208      14                                                       
HET    NAG  F1209      14                                                       
HET    NAG  F1210      14                                                       
HET    NAG  F1211      14                                                       
HET    NAG  F1212      14                                                       
HET    NAG  F1213      14                                                       
HET    NAG  F1214      14                                                       
HET    NAG  F1215      14                                                       
HET    BMA  F1216      11                                                       
HET    BMA  F1217      11                                                       
HETNAM      CA CALCIUM ION                                                      
HETNAM     NAG N-ACETYL-D-GLUCOSAMINE                                           
HETNAM     BMA BETA-D-MANNOSE                                                   
FORMUL   5   CA    CA 2+                                                        
FORMUL   6  NAG    15(C8 H15 N O6)                                              
FORMUL  21  BMA    2(C6 H12 O6)                                                 
HELIX    1   1 PRO A   39  GLU A   49  1                                  11    
HELIX    2   2 LYS A   51  LEU A   72  1                                  22    
HELIX    3   3 LEU A   82  ILE A  106  1                                  25    
HELIX    4   4 LEU A  111  GLN A  114  5                                   4    
HELIX    5   5 ASP A  115  LEU A  139  1                                  25    
HELIX    6   6 LYS A  162  ARG A  168  1                                   7    
HELIX    7   7 VAL A  169  ARG A  171  5                                   3    
HELIX    8   8 PRO A  172  GLY A  178  1                                   7    
HELIX    9   9 SER A  181  LEU A  194  1                                  14    
HELIX   10  10 LEU A  196  LEU A  215  1                                  20    
HELIX   11  11 GLU A  216  CYS A  226  1                                  11    
HELIX   12  12 ASN A  277  THR A  290  1                                  14    
HELIX   13  13 GLY A  293  ALA A  304  1                                  12    
HELIX   14  14 TRP A  309  ALA A  344  1                                  36    
HELIX   15  15 GLN A  358  GLN A  372  1                                  15    
HELIX   16  16 HIS A  426  ARG A  432  1                                   7    
HELIX   17  17 LEU A  437  LEU A  460  1                                  24    
HELIX   18  18 SER A  473  ASN A  497  1                                  25    
HELIX   19  19 ASN A  497  VAL A  503  1                                   7    
HELIX   20  20 VAL A  503  GLY A  517  1                                  15    
HELIX   21  21 ILE A  524  LEU A  535  1                                  12    
HELIX   22  22 PHE A  536  TYR A  541  5                                   6    
HELIX   23  23 SER A  544  LEU A  580  1                                  37    
HELIX   24  24 ASN A  599  GLY A  613  1                                  15    
HELIX   25  25 ASP A  615  TYR A  627  1                                  13    
HELIX   26  26 GLY A  634  VAL A  637  5                                   4    
HELIX   27  27 CYS A  638  SER A  669  1                                  32    
HELIX   28  28 THR A  799  LEU A  807  1                                   9    
HELIX   29  29 PHE A  808  ASN A  829  1                                  22    
HELIX   30  30 GLN A  830  ILE A  837  5                                   8    
HELIX   31  31 PHE A  839  SER A  862  1                                  24    
HELIX   32  32 ASN A  866  ASP A  872  1                                   7    
HELIX   33  33 ASP A  872  LEU A  885  1                                  14    
HELIX   34  34 ILE A  895  LEU A  902  5                                   8    
HELIX   35  35 PRO A  904  ALA A  911  5                                   8    
HELIX   36  36 LYS A  912  ILE A  928  1                                  17    
HELIX   37  37 ILE A  928  LYS A  951  1                                  24    
HELIX   38  38 ASN A  999  THR A 1012  1                                  14    
HELIX   39  39 GLY A 1015  ASP A 1025  1                                  11    
HELIX   40  40 ARG A 1038  GLU A 1040  5                                   3    
HELIX   41  41 MET A 1041  TYR A 1076  1                                  36    
HELIX   42  42 ASN A 1105  SER A 1117  1                                  13    
HELIX   43  43 SER A 1118  MET A 1137  1                                  20    
HELIX   44  44 GLU A 1145  LEU A 1170  1                                  26    
HELIX   45  45 PRO A 1181  ILE A 1202  1                                  22    
HELIX   46  46 ASP A 1203  THR A 1204  5                                   2    
HELIX   47  47 ARG A 1229  ARG A 1229  5                                   1    
HELIX   48  48 ILE A 1230  MET A 1241  1                                  12    
HELIX   49  49 LEU A 1243  ALA A 1250  1                                   8    
HELIX   50  50 VAL A 1253  GLN A 1265  1                                  13    
HELIX   51  51 LEU A 1267  GLN A 1287  1                                  21    
HELIX   52  52 THR A 1308  CYS A 1319  1                                  12    
HELIX   53  53 ALA A 1320  GLY A 1322  5                                   3    
HELIX   54  54 ALA A 1324  SER A 1333  1                                  10    
HELIX   55  55 ALA A 1357  ASN A 1383  1                                  27    
HELIX   56  56 ASN A 1383  GLY A 1395  1                                  13    
HELIX   57  57 UNK A 1400  UNK A 1411  1                                  12    
HELIX   58  58 UNK A 1416  UNK A 1423  1                                   8    
HELIX   59  59 UNK A 1423  UNK A 1434  1                                  12    
HELIX   60  60 UNK A 1440  UNK A 1454  1                                  15    
HELIX   61  61 UNK A 1459  UNK A 1475  1                                  17    
HELIX   62  62 UNK A 1479  UNK A 1484  5                                   6    
HELIX   63  63 UNK A 1487  UNK A 1498  1                                  12    
HELIX   64  64 UNK A 1505  UNK A 1520  1                                  16    
HELIX   65  65 ARG B   42  THR B   57  1                                  16    
HELIX   66  66 ALA B   73  ASP B   77  5                                   5    
HELIX   67  67 SER B  120  ALA B  135  1                                  16    
HELIX   68  68 TYR B  239  PHE B  257  1                                  19    
HELIX   69  69 ASP B  269  ALA B  273  5                                   5    
HELIX   70  70 SER B  295  ALA B  310  1                                  16    
HELIX   71  71 ARG B  311  LEU B  313  5                                   3    
HELIX   72  72 HIS B  325  THR B  332  5                                   8    
HELIX   73  73 SER B  345  ARG B  356  1                                  12    
HELIX   74  74 LEU B  364  CYS B  377  1                                  14    
HELIX   75  75 PRO B  378  PHE B  383  1                                   6    
HELIX   76  76 GLN B  391  HIS B  411  1                                  21    
HELIX   77  77 PRO B  412  ASN B  416  5                                   5    
HELIX   78  78 ALA E    6  SER E   29  1                                  24    
HELIX   79  79 PHE E   97  ALA E  128  1                                  32    
HELIX   80  80 LYS E  131  ILE E  166  1                                  36    
HELIX   81  81 TRP E  180  LEU E  204  1                                  25    
HELIX   82  82 UNK F   52  UNK F   54  5                                   3    
HELIX   83  83 UNK F   55  ASP F   68  1                                  14    
HELIX   84  84 ALA F   77  ALA F  112  1                                  36    
HELIX   85  85 SER F  178  GLU F  201  1                                  24    
HELIX   86  86 ARG F  243  GLY F  249  1                                   7    
HELIX   87  87 GLY F  268  LEU F  285  1                                  18    
HELIX   88  88 VAL F  314  ASN F  326  1                                  13    
HELIX   89  89 TYR F  335  ASN F  348  1                                  14    
HELIX   90  90 ALA F  371  ASN F  379  1                                   9    
HELIX   91  91 ARG F  398  ASN F  408  1                                  11    
HELIX   92  92 GLY F  419  LEU F  429  1                                  11    
HELIX   93  93 ASP F  430  LEU F  432  5                                   3    
HELIX   94  94 GLY F  433  LEU F  438  1                                   6    
HELIX   95  95 LEU F  485  GLY F  491  1                                   7    
HELIX   96  96 ASP F  562  GLU F  567  1                                   6    
HELIX   97  97 ASP F  571  ILE F  581  1                                  11    
HELIX   98  98 GLU F  639  LYS F  652  1                                  14    
HELIX   99  99 UNK F  663  UNK F  677  1                                  15    
HELIX  100 100 UNK F  681  UNK F  697  1                                  17    
HELIX  101 101 UNK F  732  UNK F  751  1                                  20    
HELIX  102 102 UNK F  752  UNK F  765  1                                  14    
HELIX  103 103 UNK F  778  UNK F  799  1                                  22    
HELIX  104 104 UNK F  859  UNK F  867  1                                   9    
HELIX  105 105 UNK F  903  UNK F  912  1                                  10    
HELIX  106 106 UNK F  931  UNK F  938  1                                   8    
HELIX  107 107 ILE F  978  ASP F  989  1                                  12    
SHEET    1   A 2 VAL A 974  TYR A 975  0                                        
SHEET    2   A 2 MET A 983  GLU A 984 -1  O  GLU A 984   N  VAL A 974           
SHEET    1   B 5 GLY B 116  PRO B 119  0                                        
SHEET    2   B 5 TRP B 103  LEU B 108 -1  N  TRP B 104   O  ILE B 118           
SHEET    3   B 5 PHE B  92  GLU B  97 -1  N  GLU B  97   O  ILE B 105           
SHEET    4   B 5 PHE B  62  THR B  66 -1  N  VAL B  64   O  LEU B  93           
SHEET    5   B 5 TYR B 220  VAL B 223 -1  O  ASP B 221   N  ARG B  65           
SHEET    1   C 3 VAL B 229  VAL B 232  0                                        
SHEET    2   C 3 ILE B 337  TYR B 340  1  O  VAL B 339   N  VAL B 230           
SHEET    3   C 3 VAL B 385  ILE B 386  1  O  VAL B 385   N  TYR B 340           
SHEET    1   D 2 ALA E  33  LEU E  35  0                                        
SHEET    2   D 2 TYR E 177  SER E 179 -1  O  TYR E 178   N  VAL E  34           
SHEET    1   E 2 UNK F  44  UNK F  45  0                                        
SHEET    2   E 2 UNK F  49  UNK F  50 -1  O  UNK F  49   N  UNK F  45           
SHEET    1   F 5 ALA F 166  ALA F 167  0                                        
SHEET    2   F 5 LEU F 216  TYR F 219 -1  O  ARG F 218   N  ALA F 167           
SHEET    3   F 5 TRP F 207  GLY F 211 -1  N  PHE F 210   O  ALA F 217           
SHEET    4   F 5 THR F 479  GLN F 484 -1  O  ASN F 480   N  VAL F 209           
SHEET    5   F 5 VAL F 461  LEU F 466 -1  N  LEU F 466   O  THR F 479           
SHEET    1   G 5 ALA F 300  ASP F 302  0                                        
SHEET    2   G 5 VAL F 291  PHE F 296 -1  N  SER F 295   O  GLN F 301           
SHEET    3   G 5 ASP F 255  VAL F 260  1  N  ILE F 258   O  ALA F 294           
SHEET    4   G 5 LYS F 358  THR F 364  1  O  MET F 361   N  LEU F 259           
SHEET    5   G 5 VAL F 384  SER F 390  1  O  PHE F 389   N  LEU F 362           
SHEET    1   H 3 LYS F 500  ARG F 501  0                                        
SHEET    2   H 3 SER F 620  LEU F 624 -1  O  LEU F 624   N  LYS F 500           
SHEET    3   H 3 TYR F 609  PRO F 613 -1  N  THR F 610   O  ALA F 623           
SHEET    1   I 2 VAL F 594  SER F 596  0                                        
SHEET    2   I 2 ASP F 603  GLY F 605 -1  O  ASP F 603   N  SER F 596           
SHEET    1   J 2 UNK F 806  UNK F 807  0                                        
SHEET    2   J 2 UNK F 818  UNK F 819 -1  O  UNK F 818   N  UNK F 807           
SHEET    1   K 2 UNK F 827  UNK F 832  0                                        
SHEET    2   K 2 UNK F 839  UNK F 844 -1  O  UNK F 841   N  UNK F 830           
SSBOND   1 CYS F  406    CYS F 1062                          1555   1555  2.03  
CISPEP   1 PRO A   73    MET A   74          0        -3.95                     
CISPEP   2 ILE A  256    ASN A  257          0         1.97                     
CISPEP   3 ILE A  305    GLY A  306          0         2.00                     
CISPEP   4 TYR A  435    TRP A  436          0        -0.64                     
CISPEP   5 HIS A  462    LEU A  463          0        -3.02                     
CISPEP   6 PRO A  521    LEU A  522          0         1.55                     
CISPEP   7 ASP A  589    THR A  590          0        -2.63                     
CISPEP   8 GLU A  591    VAL A  592          0        -0.86                     
CISPEP   9 ASN A  958    ASP A  959          0       -11.16                     
CISPEP  10 GLN A  989    TRP A  990          0        -2.84                     
CISPEP  11 PRO A 1033    VAL A 1034          0         1.78                     
CISPEP  12 GLN A 1142    SER A 1143          0        -1.15                     
CISPEP  13 UNK A 1415    UNK A 1416          0        -1.73                     
CISPEP  14 GLY B  233    PRO B  234          0        -2.63                     
CISPEP  15 GLU F  123    VAL F  124          0        -6.98                     
CISPEP  16 VAL F  124    VAL F  125          0        -2.53                     
CISPEP  17 PRO F  203    SER F  204          0         5.03                     
CISPEP  18 PRO F  224    TRP F  225          0         7.06                     
CISPEP  19 SER F  252    PRO F  253          0       -11.60                     
CISPEP  20 HIS F  308    LEU F  309          0       -14.06                     
CISPEP  21 GLU F  557    PRO F  558          0       -13.36                     
CISPEP  22 ALA F  636    LYS F  637          0        -4.26                     
CISPEP  23 UNK F  868    UNK F  869          0         9.20                     
CISPEP  24 UNK F  875    UNK F  876          0         4.18                     
CISPEP  25 PHE F 1063    ASP F 1064          0        -3.21                     
SITE     1 AC1  1 GLY A1322                                                     
SITE     1 AC2  1 ASN F 350                                                     
SITE     1 AC3  1 ASN F 326                                                     
SITE     1 AC4  2 ASN F 615  NAG F1204                                          
SITE     1 AC5  1 NAG F1203                                                     
SITE     1 AC6  1 ASN F 988                                                     
SITE     1 AC7  2 NAG F1207  BMA F1216                                          
SITE     1 AC8  4 ASN F 122  ASN F 186  ALA F 190  NAG F1206                    
SITE     1 AC9  3 GLN F 110  ASN F 470  NAG F1209                               
SITE     1 BC1  3 TRP F 115  NAG F1208  BMA F1217                               
SITE     1 BC2  3 ASN F  94  ASP F 202  PRO F 203                               
SITE     1 BC3  2 ARG F 591  ASN F 606                                          
SITE     1 BC4  4 GLU F 569  LYS F 595  ASN F1001  NAG F1213                    
SITE     1 BC5  2 LYS F 595  NAG F1212                                          
SITE     1 BC6  1 NAG F1215                                                     
SITE     1 BC7  1 NAG F1214                                                     
SITE     1 BC8  1 NAG F1206                                                     
SITE     1 BC9  1 NAG F1209                                                     
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1           1          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.002959  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.002959  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.002959        0.00000                         
(ATOM LINES ARE NOT SHOWN.)
END                                                                             
DBGET integrated database retrieval system