KEGG   Clostridioides difficile 630: CDIF630_01199Help
Entry
CDIF630_01199     CDS       T03885                                 

Gene name
thlA1
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdc  Clostridioides difficile 630
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pdc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDIF630_01199 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    CDIF630_01199 (thlA1)
   00640 Propanoate metabolism
    CDIF630_01199 (thlA1)
   00650 Butanoate metabolism
    CDIF630_01199 (thlA1)
  Lipid metabolism
   00071 Fatty acid degradation
    CDIF630_01199 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    CDIF630_01199 (thlA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDIF630_01199 (thlA1)
   00310 Lysine degradation
    CDIF630_01199 (thlA1)
   00380 Tryptophan metabolism
    CDIF630_01199 (thlA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDIF630_01199 (thlA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDIF630_01199 (thlA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CDIF630_01199 (thlA1)
Enzymes [BR:pdc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDIF630_01199 (thlA1)
Exosome [BR:pdc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDIF630_01199 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1236396..1237571
Genome map
AA seq 391 aa AA seqDB search
MREVVIASAARTAVGSFGGAFKSVSAVELGVTAAKEAIKRANITPDMIDESLLGGVLTAG
LGQNIARQIALGAGIPVEKPAMTINIVCGSGLRSVSMASQLIALGDADIMLVGGAENMSM
SPYLVPSARYGARMGDAAFVDSMIKDGLSDIFNNYHMGITAENIAEQWNITREEQDELAL
ASQNKAEKAQAEGKFDEEIVPVVIKGRKGDTVVDKDEYIKPGTTMEKLAKLRPAFKKDGT
VTAGNASGINDGAAMLVVMAKEKAEELGIEPLATIVSYGTAGVDPKIMGYGPVPATKKAL
EAANMTIEDIDLVEANEAFAAQSVAVIRDLNIDMNKVNVNGGAIAIGHPIGCSGARILTT
LLYEMKRRDAKTGLATLCIGGGMGTTLIVKR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagtaattgccagtgcagctagaacagcagtaggaagttttggaggagca
tttaaatcagtttcagcggtagagttaggggtaacagcagctaaagaagctataaaaaga
gctaacataactccagatatgatagatgaatctcttttagggggagtacttacagcaggt
cttggacaaaatatagcaagacaaatagcattaggagcaggaataccagtagaaaaacca
gctatgactataaatatagtttgtggttctggattaagatctgtttcaatggcatctcaa
cttatagcattaggtgatgctgatataatgttagttggtggagctgaaaacatgagtatg
tctccttatttagtaccaagtgcgagatatggtgcaagaatgggtgatgctgcttttgtt
gattcaatgataaaagatggattatcagacatatttaataactatcacatgggtattact
gctgaaaacatagcagagcaatggaatataactagagaagaacaagatgaattagctctt
gcaagtcaaaataaagctgaaaaagctcaagctgaaggaaaatttgatgaagaaatagtt
cctgttgttataaaaggaagaaaaggtgacactgtagtagataaagatgaatatattaag
cctggcactacaatggagaaacttgctaagttaagacctgcatttaaaaaagatggaaca
gttactgctggtaatgcatcaggaataaatgatggtgctgctatgctagtagtaatggct
aaagaaaaagctgaagaactaggaatagagcctcttgcaactatagtttcttatggaaca
gctggtgttgaccctaaaataatgggatatggaccagttccagcaactaaaaaagcttta
gaagctgctaatatgactattgaagatatagatttagttgaagctaatgaggcatttgct
gcccaatctgtagctgtaataagagacttaaatatagatatgaataaagttaatgttaat
ggtggagcaatagctataggacatccaataggatgctcaggagcaagaatacttactaca
cttttatatgaaatgaagagaagagatgctaaaactggtcttgctacactttgtataggt
ggtggaatgggaactactttaatagttaagagatag

DBGET integrated database retrieval system