KEGG   Paracoccus denitrificans: Pden_0251Help
Entry
Pden_0251         CDS       T00440                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pde  Paracoccus denitrificans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pden_0251
Enzymes [BR:pde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pden_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:233732..234574
Genome map
AA seq 280 aa AA seqDB search
MARTSCAVVVGSLHYDIVVSAPHRPAAGETVTGTAWHPVFGGKGGNQAVAVVRAGVACRI
VSAVGDDDFGLFLRGHLEASGVDAAHVATLPGTGSGMSVAIMDAGGDYGAVIVSGANLAI
DPAVLDRDALWDGASHLVLQNEIPEALNIAAARAARARGLRVVLNAAPARDLSADLAATI
DILVVNAGEAEALSGIVVESLEDARHAASALADRFRIVVVTAGTEGAHSEPGRRVKLVST
HGAGDCFIGTLVAELAHGGDLRYSVRQANLAAAKHVSRAE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcacttcctgcgctgtcgtcgtcggcagcttgcactatgacatcgtcgtctcg
gcgccccatcgcccggcggcgggcgaaaccgtcaccggcacggcctggcacccggtcttc
ggcggcaagggcggcaaccaggcggtcgcggtcgtgcgggccggggtggcgtgccggata
gtctcggccgtgggggacgacgatttcggcctgttcttgcgcggccatctggaggcctcg
ggggtggacgccgcccatgtcgccacattgcccggcaccggctcggggatgagcgtcgcg
atcatggatgccggcggggattacggcgcggtgatcgtctcgggcgccaatctggcgatt
gatccggcggttctggaccgcgatgcgctatgggacggggccagccatctggtcctgcaa
aacgagatccccgaggcgctgaacatcgccgcggcccgcgccgcgcgggcgcgcgggttg
cgcgtagtgctgaacgcggcgccggcccgtgacctgtccgccgatctggccgcgacgatc
gacattctggtcgtcaacgcgggcgaggccgaggcactgagcggtatcgtggtcgaaagc
cttgaggatgcccggcacgcagcatccgccttggcagatcgcttccgtatcgtcgtcgtg
acggccggcaccgagggcgcacattccgaacccggacgcagggtaaagctggtcagtacc
cacggcgctggcgactgcttcatcggcacactggtcgctgaacttgcccatggcggtgac
ctgagatacagcgtcaggcaggccaatctggcggcggcgaaacacgtctcacgggctgag
tga

DBGET integrated database retrieval system