KEGG   Paracoccus denitrificans: Pden_0333Help
Entry
Pden_0333         CDS       T00440                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pde  Paracoccus denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pden_0333
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pden_0333
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pden_0333
Enzymes [BR:pde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pden_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(315957..316754)
Genome map
AA seq 265 aa AA seqDB search
MSRIDDTFARLSETGGKAFVAYMMGCDPDFDTSLQIMRGLPGAGVDIIELGMPFTDPMAD
GATIQAAGQRALAAGGSVSRVLDMVRAFRRDDDATPIVLMGYYNPIYARQGGVDRFITEA
VEAGVDGLIVVDLPPEEDAELCLPAREAGLNFIRLATPTTDDRRLPAVVRNTSGFVYYVS
VTGITGGPAANAAEVAPEVARIRAAAKLPVVVGFGISTPEAAQAVAGVADGCVVGSAIVK
LIGEGRPVPEILSFVADLAQGAHSA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatcgacgacactttcgcgcggctgtccgagacgggcggcaaggccttcgtc
gcctatatgatgggctgcgacccggatttcgacacctcgctgcagatcatgcgcggcctg
cccggcgcgggcgtggacatcatcgaactgggcatgcccttcaccgacccgatggccgac
ggcgccaccatccaggcggcgggccagcgcgcgctggcggccggcggcagcgtcagcagg
gtgctggacatggtgcgcgcctttcgccgggacgacgatgccacccccatcgtgctgatg
ggctattacaacccgatctatgcccggcagggcggcgtggaccgcttcatcaccgaggcg
gtcgaggccggcgtggacgggctgatcgtcgtcgacctgccgcccgaagaggatgccgag
ctgtgcctgccggcacgcgaggccgggctgaacttcatccgcctggcaacgccgacgacc
gacgaccggcgcctgcctgcggtggtgcgcaataccagcggcttcgtctattacgtctcg
gtcaccggcatcaccggcgggcccgcagccaatgccgcagaggtcgcgccagaggtcgcc
cgcatccgcgccgccgccaagctgccggtcgtcgtcggcttcggcatatcgacgccggag
gcagcgcaggccgtggcgggcgtcgccgatggctgcgtcgtgggcagtgccatcgtcaag
ctgatcggcgagggccgcccggtgcccgagatcctgtccttcgtcgcagacctggcccag
ggcgcgcacagcgcctga

DBGET integrated database retrieval system