KEGG   Paracoccus denitrificans: Pden_0333Help
Entry
Pden_0333         CDS       T00440                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pde  Paracoccus denitrificans
Pathway
pde00260  Glycine, serine and threonine metabolism
pde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01130  Biosynthesis of antibiotics
pde01230  Biosynthesis of amino acids
Module
pde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pden_0333
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pden_0333
Enzymes [BR:pde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pden_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB GDPD_2
Motif
Other DBs
NCBI-ProteinID: ABL68447
JGI: Pden0333
UniProt: A1AYV3
Position
1:complement(315957..316754)
Genome map
AA seq 265 aa AA seqDB search
MSRIDDTFARLSETGGKAFVAYMMGCDPDFDTSLQIMRGLPGAGVDIIELGMPFTDPMAD
GATIQAAGQRALAAGGSVSRVLDMVRAFRRDDDATPIVLMGYYNPIYARQGGVDRFITEA
VEAGVDGLIVVDLPPEEDAELCLPAREAGLNFIRLATPTTDDRRLPAVVRNTSGFVYYVS
VTGITGGPAANAAEVAPEVARIRAAAKLPVVVGFGISTPEAAQAVAGVADGCVVGSAIVK
LIGEGRPVPEILSFVADLAQGAHSA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatcgacgacactttcgcgcggctgtccgagacgggcggcaaggccttcgtc
gcctatatgatgggctgcgacccggatttcgacacctcgctgcagatcatgcgcggcctg
cccggcgcgggcgtggacatcatcgaactgggcatgcccttcaccgacccgatggccgac
ggcgccaccatccaggcggcgggccagcgcgcgctggcggccggcggcagcgtcagcagg
gtgctggacatggtgcgcgcctttcgccgggacgacgatgccacccccatcgtgctgatg
ggctattacaacccgatctatgcccggcagggcggcgtggaccgcttcatcaccgaggcg
gtcgaggccggcgtggacgggctgatcgtcgtcgacctgccgcccgaagaggatgccgag
ctgtgcctgccggcacgcgaggccgggctgaacttcatccgcctggcaacgccgacgacc
gacgaccggcgcctgcctgcggtggtgcgcaataccagcggcttcgtctattacgtctcg
gtcaccggcatcaccggcgggcccgcagccaatgccgcagaggtcgcgccagaggtcgcc
cgcatccgcgccgccgccaagctgccggtcgtcgtcggcttcggcatatcgacgccggag
gcagcgcaggccgtggcgggcgtcgccgatggctgcgtcgtgggcagtgccatcgtcaag
ctgatcggcgagggccgcccggtgcccgagatcctgtccttcgtcgcagacctggcccag
ggcgcgcacagcgcctga

DBGET integrated database retrieval system