KEGG   Paracoccus denitrificans: Pden_0518Help
Entry
Pden_0518         CDS       T00440                                 

Definition
superoxide dismutase
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pde  Paracoccus denitrificans
Brite
Enzymes [BR:pde01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Pden_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:488754..489353
Genome map
AA seq 199 aa AA seqDB search
MAFTLPDLPYAHDALAAGGMSKETLEYHHDKHHKAYVDKLNELVAGTEWEGKSLEDIVKG
TYQSGAVAQNGIFNNASQHWNHAQFWEMMGPNPGAIPGELEKALTEAFGSVDEFKKKFAE
AGVGQFGSGWAWLVKDKDGSLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNARPK
YLENFLNNLVNWENVASRL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccttcacgcttcccgatcttccctatgctcacgacgcgctggctgctggcggcatg
tccaaggagacgctggaataccaccacgacaagcaccacaaggcctatgtcgacaagctg
aacgagctggtggcaggcaccgaatgggaaggcaagagcctcgaggacatcgtcaagggc
acctaccagtcgggcgccgtggcgcagaacggcatcttcaacaatgccagccagcactgg
aaccatgcccagttctgggaaatgatgggcccgaaccccggcgccatcccgggcgagctg
gaaaaggccctgaccgaagccttcggttcggtggacgaattcaagaagaaattcgccgag
gccggcgtcggccagttcggttcgggctgggcctggctcgtcaaggacaaggacggcagc
ctgaaggtcaccaagaccgagaacggcgtgaacccgctttgcttcggccagaccgcgctt
ctgggctgcgacgtgtgggagcacagctattacatcgacttccgcaacgcccggccgaaa
tacctggaaaatttcctgaacaacctggtgaactgggaaaacgtggcctcgcgcctctga

DBGET integrated database retrieval system