KEGG   Paracoccus denitrificans: Pden_0544Help
Entry
Pden_0544         CDS       T00440                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pde  Paracoccus denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pde00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:517064..518035
Genome map
AA seq 323 aa AA seqDB search
MTDYFRPIPCETGRWQLAGGWVRFSQFELLRRGEVPRVVDSVPEAVLAALIAPRAPLLGL
SMDRPRIMGIVNATPDSFSDGGSYDGAEQARLLAGQGAEILDIGGESTRPGAREVPVAEE
IARVAPAIAAARGLAAVSIDTRKAGVARAAIVAGAGLVNDVSGFDFDPDMAGLVAAAGVP
VCLMHAQGIPETMQDNPTYGDVLLDVYDALAERIARAEAAGIPRDRIVIDPGIGFGKTQA
HNLAILRRISLYHGLGCTVLLGVSRKRFIGSIGGAERPADRVAGTLALTLAGIAQGIQIH
RVHDAAETRQGLALWRAVTAETR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattattttcgccccattccctgtgagacgggtcgctggcaattggccggcggt
tgggtgcgcttttcgcaattcgagcttttgcgccgcggcgaggtgccccgcgtggtggac
agcgtccccgaggcggtgctggcggcgctgatcgcgcctcgcgcgccgcttctgggcctt
tccatggatcgcccccgcatcatggggatcgtcaacgccacgcccgacagtttctcggac
ggcggaagctatgacggggccgagcaggcgcggctgctggccgggcagggggccgagatc
ctggatatcggcggcgaatcaaccaggccgggtgcccgcgaagtgccggtggccgaggaa
atcgcccgcgtggcccccgccattgccgcggcgcgggggctggcggcggtctcgatcgat
acccgcaaggcaggggtggcgcgggccgccatcgtggccggggcggggttggtcaacgat
gtttcgggcttcgacttcgacccggacatggccgggctggtggcggcggccggcgtgccg
gtctgcctgatgcacgcccagggcattcccgaaaccatgcaggacaacccgacctatggc
gatgtgctgctggacgtctacgacgccctggccgagcgtatcgcgcgggccgaggcggcg
ggcatcccccgcgacaggatcgtgatcgatcccggcattggtttcggcaagacgcaggcg
cataatctggccatcctgcggcgcatctcgctctaccatgggttgggttgcaccgtgctg
ctgggggtttcgcgcaagcggttcatcggcagcatcggcggggcagagcgcccggccgac
cgggtggcgggaacgctggcgctgacgctggccgggatcgcgcaggggatacagatccac
cgcgtccatgacgcggcagaaacacggcagggcctcgctctttggcgggccgtaaccgca
gagacaagatga

DBGET integrated database retrieval system