KEGG   Paracoccus denitrificans: Pden_0559Help
Entry
Pden_0559         CDS       T00440                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pde  Paracoccus denitrificans
Pathway
pde00020  Citrate cycle (TCA cycle)
pde00640  Propanoate metabolism
pde00660  C5-Branched dibasic acid metabolism
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
pde01200  Carbon metabolism
Module
pde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pden_0559
   00640 Propanoate metabolism
    Pden_0559
   00660 C5-Branched dibasic acid metabolism
    Pden_0559
Enzymes [BR:pde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pden_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A MazG
Motif
Other DBs
NCBI-ProteinID: ABL68671
JGI: Pden0559
UniProt: A1AZH7
Position
1:complement(531478..532671)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLRQYGAPVSDGRVVMKADEAKAAAGELDGPLWVVKAQIHAGGRGKGHFK
EKEAGEKGGVRLAKSVEEAEELARQMLGRTLVTHQTGETGKQVNRIYIEDGSDIERELYL
ALLVDRGTSRVSFVASTEGGMDIEEVAASTPEKIVSFSVDPASGLSDFHGRRVAFALGLS
GAQVKQCVALVKNLYRMFIEKDMEMLEINPLIVMKDGNLKALDAKMGFDNNALYRQPDIL
ALRDETEEDPKELAASKFDLNYIALDGEIGCMVNGAGLAMATMDIIKLFGAEPANFLDVG
GGATKEKVTEAFKIITSDPNVKGILVNIFGGIMRCDIIAEGIIAAVKEVGLQVPLVVRLE
GTNVELGKQIIGESGLNVIAADDLSDAAQKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaataccaggccaaggcgctgctgcgccaatacggcgcgccggtctcc
gacgggcgggtggtgatgaaggcggacgaagccaaggcggcggcgggggaactcgacggg
ccgctctgggtcgtcaaggcgcagatccatgccggcggccgtggcaagggtcacttcaag
gaaaaggaagccggtgaaaagggcggcgtccgcctggcaaaatcggtcgaagaggccgag
gaactggcccgccagatgctgggccgcaccctggtcacccaccagacgggcgagaccggc
aagcaggtcaaccgcatctatatcgaggacggctcggacatcgagcgcgagctttacctg
gcgctgctggtcgaccgcggcacctcgcgcgtcagcttcgtcgcctcgaccgaaggcggc
atggacatcgaggaagtcgccgcctcgaccccggaaaagatcgtcagcttcagcgtcgat
ccggcctcggggctttcggatttccacggccgccgcgtggccttcgccctgggtctttcg
ggcgcgcaggtcaagcaatgcgtggcgctggtcaagaacctgtatcgcatgttcatcgaa
aaggacatggagatgctggagatcaacccgctgatcgtgatgaaggacggcaacctcaag
gcgctggacgcgaagatgggcttcgacaacaacgccctgtatcgccagcccgacatcctg
gcgctgcgtgacgagaccgaggaagatccgaaggaactggcggcgtccaagttcgacctg
aactacatcgcgctggacggcgagatcggttgcatggtgaacggcgccggcctggccatg
gccaccatggacatcatcaagctgttcggggcggaacccgcgaacttccttgacgtgggc
ggcggcgccaccaaggaaaaggtgaccgaggcgttcaagatcatcacctcggacccgaac
gtgaagggtatcctggtcaacatcttcggcggcatcatgcgctgcgacatcatcgcggaa
ggcatcatcgccgccgtgaaggaagtcgggctgcaagtcccgctggtcgtgcgtcttgag
ggcaccaacgtcgagctgggcaagcagatcatcggcgagtccggcctgaacgtgatcgcg
gccgacgacctgtcggatgcggcgcagaagatcgtgaaagcggtgaaaggataa

DBGET integrated database retrieval system