KEGG   Paracoccus denitrificans: Pden_0568Help
Entry
Pden_0568         CDS       T00440                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pde  Paracoccus denitrificans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pden_0568
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pden_0568
   00650 Butanoate metabolism
    Pden_0568
  Energy metabolism
   00190 Oxidative phosphorylation
    Pden_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:541566..541955
Genome map
AA seq 129 aa AA seqDB search
MRYITPRKAAEGLGSAHEGTQHHWAMTVSAVALTVLTPLFMIVVARAIGLSQEQLLAYFG
RPFPALITALFVIVGMVHFIKGTRIMIDDYFQGGTRKAAIIFSVIFGWAVIAAAVYALAR
MGLGAIVVL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcaccccccgcaaagccgccgaaggcctgggctcggcccacgaaggcacc
cagcatcactgggccatgaccgtctcggccgtggcgctgaccgtgctgacgccgctgttc
atgatcgtcgtggcccgcgccatcggcctgtcgcaggaacagttgctggcctatttcggc
cgtcccttcccggcgctcatcaccgctctgttcgtgatcgtgggcatggtccacttcatc
aagggcacgcggatcatgatcgacgactatttccagggtggcacgcgcaaggcggccatc
atcttttccgtcatcttcggctgggcggtcatcgccgcagccgtctatgcgctggcccgg
atgggccttggcgcgatcgtcgtcctctga

DBGET integrated database retrieval system