KEGG   Paracoccus denitrificans: Pden_0851Help
Entry
Pden_0851         CDS       T00440                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pde  Paracoccus denitrificans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Pden_0851
Enzymes [BR:pde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Pden_0851
    3.5.1.-  
     Pden_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:839444..840040
Genome map
AA seq 198 aa AA seqDB search
MAKALIVIDMQLDFCPGGRLAVAGGDEIVAAINDLMADFDAVVLTQDWHPHDHASFADNH
PGAAAFSVVDMPYGPQVLWPAHCVIGTDGAGFHPTLAADCADLVIRKGFRPHIDSYSAFF
ENDHRTPTGLAGYLRDRGMDDLTFVGLAHDFCVAWSAIDAAKLGFRATVIEDATRAIDLN
GSREAAREDMRKAGVTLA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggccctgatcgtcatcgacatgcaactggatttctgcccgggcgggcggctt
gccgtggccggcggggacgagatcgtcgccgcgatcaacgacctgatggcggatttcgac
gccgtggtgctgacgcaggactggcacccccacgaccatgccagctttgccgacaaccat
cccggcgcggcggcattttcggtcgtggacatgccctacgggccgcaggtgctctggccc
gcgcattgcgtgatcgggaccgatggcgcgggctttcacccgacgctggccgccgattgc
gccgatctggtgatccgcaagggttttcgcccgcatatcgacagctattccgcgtttttc
gagaacgatcaccgcacccccaccggcctagccggatacttgcgcgaccgcggcatggac
gacctgacctttgtcgggctggcgcatgatttctgcgtcgcctggtcggccatcgatgcg
gcgaagctgggtttccgcgccaccgtgatcgaggacgccacccgcgccatcgacctgaac
ggctcgcgcgaggcggcgcgcgaggacatgcgcaaggcgggggtaacactggcatga

DBGET integrated database retrieval system