KEGG   Paracoccus denitrificans: Pden_0882Help
Entry
Pden_0882         CDS       T00440                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pde  Paracoccus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pden_0882
   01230 Biosynthesis of amino acids
    Pden_0882
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_0882
   00030 Pentose phosphate pathway
    Pden_0882
   00051 Fructose and mannose metabolism
    Pden_0882
   00052 Galactose metabolism
    Pden_0882
  Energy metabolism
   00680 Methane metabolism
    Pden_0882
Enzymes [BR:pde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pden_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(867833..868792)
Genome map
AA seq 319 aa AA seqDB search
MDQAPILTITLNPALDVTTAARQVVPDIKLRCEAPRFDPGGGGINVSRAIRAMGGDSTAL
VALGGATGQRIAGLLEETGIPLMTLPAPGETRQSLTVDDRTIRQQYRFVMPGPEWSAADV
EAALDTAAGAAAPGALVVLSGSNPPGVPVRFAAMLAERLRGTGARLIVDTSGKALAEVAS
ATDRRVEILRMDDEEAQGLAGRPLPYRADTAAFAAGLVASGAAHGVIVARGRDGNIIATD
QGIWHAEAARVQVVSKVGAGDSFLAGFTLGHARGWPVCDALGLAAAAASATVQTPATELC
RGEDVERLFAARMVTRMGA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggcaccgatcctgaccatcacgctgaacccggcgctggacgtcaccaccgcc
gcgcggcaggtggtgcccgacatcaagctgcgctgcgaggcgccgcgcttcgacccgggc
ggcggcggcatcaatgtcagccgggcgatccgcgccatgggtggcgacagcaccgcgctg
gtggcgcttggcggcgcgaccgggcaacgcatcgccgggctgctggaggaaaccggcatc
ccgctcatgaccctgcccgcgccgggcgagacgcggcagtccctgaccgtggacgaccgc
accatccgccagcaataccgtttcgtcatgcccggcccggaatggtccgcggccgatgtc
gaggccgcgctggacaccgccgccggggcagctgcacccggtgcgctggtggtgctgtcg
ggctcgaacccgccgggggtgccggtgcgctttgccgccatgctggccgagcggctgcgc
ggcaccggcgcgcggctgatcgtcgacacctcgggcaaggcgctggccgaggtcgcatcc
gccaccgaccgccgggtcgagatcctgcgcatggacgacgaagaggcccaggggctggcc
ggccgccccctgccctatcgcgccgacacggccgccttcgcggcggggctcgtcgcctcg
ggtgcggcgcatggggtgatcgtggcgcgcggtcgcgacggcaatatcatcgccaccgac
cagggcatctggcatgccgaggccgcgcgggtgcaggtggtcagcaaggtcggcgccggc
gacagtttcctggccggcttcacgctgggccatgcccgcggctggccggtctgcgatgcg
ctggggctggcggcggccgccgcctcggcgacagtgcagacccccgcgaccgagctgtgc
cggggcgaggatgtcgagcggctgttcgccgcccgcatggtcacgcggatgggcgcctag

DBGET integrated database retrieval system