KEGG   Paracoccus denitrificans: Pden_0893Help
Entry
Pden_0893         CDS       T00440                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pde  Paracoccus denitrificans
Brite
Enzymes [BR:pde01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Pden_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(876043..877065)
Genome map
AA seq 340 aa AA seqDB search
MAQTEAIDDSALREEAKGVFEALPEKMTAIKQTEENPEGIALTAEKIELGKMLFFDPRMS
SSGLISCQTCHNVGLGGVDGLPTSIGHGWQRGPRNAPTMLNAIFNAAQFWDGRAGDLAEQ
AKGPVQAGVEMSNTPDQVVQTINSMPEYVDAFKAAFPDEAEPVSFDNFAVAIEQFEATLI
TPNSAFDRFLAGDDAAMSDQQKRGLQAFIETGCTACHYGINLGGQDYHPFGLIARPGAEV
LPAGDKGRYEISQTADDEYVFRAAPLRNVALTAPYFHSGVVWDLAEAVQIMSSAQIGTEL
TDQQANDITAFLGALTGEQPVIDHPILPVRTDTTPLPTPM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaccgaagccatcgacgacagcgccctgcgcgaggaagccaagggggtgttc
gaggcgcttcccgagaagatgacggcgatcaagcagaccgaggaaaaccccgagggcatc
gcgctgaccgccgaaaagatcgagctgggcaagatgctgttcttcgacccgcgcatgtcc
agttccggcctgatttcatgccagacctgccacaacgtcggcctgggcggggtggacggc
ctgccgacttcgatcgggcacggctggcagcgggggccgcgcaacgcccccaccatgctg
aacgcgatcttcaacgccgcgcagttctgggacgggcgcgcgggcgacctggcggaacag
gcgaaaggtccggtccaggccggcgtcgagatgagcaacacccccgatcaggtggtccag
accatcaattcgatgccggaatatgtcgacgccttcaaggccgccttcccggatgaggca
gagccggtcagcttcgacaacttcgccgttgcgatcgagcagttcgaggccacgctgatc
acgccgaacagcgccttcgaccgcttcctggccggcgacgatgcggcgatgtccgaccag
cagaagcgcggcctgcaagcctttatcgagaccggctgcaccgcctgccactacggcatc
aacctgggcgggcaggactatcaccccttcggcctgatcgccaggcccggcgccgaggtg
ctgcccgcaggcgacaagggccgctacgagatcagccagaccgcggatgacgaatacgtc
ttccgggccgcgccgctgcgcaacgtggcgctgaccgcaccctatttccattcgggcgtg
gtctgggatctggcggaagcggtgcagatcatgtcctcggcccagatcggcaccgaactg
accgatcagcaggccaacgacatcaccgccttcctgggcgcattgacgggcgagcaaccg
gtgatcgaccacccgatcctgccggtgcgcaccgacacgacaccgctgcccacgccgatg
taa

DBGET integrated database retrieval system