KEGG   Paracoccus denitrificans: Pden_0932Help
Entry
Pden_0932         CDS       T00440                                 

Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase
  KO
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pde  Paracoccus denitrificans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Pden_0932
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Pden_0932
Enzymes [BR:pde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Pden_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:913215..913997
Genome map
AA seq 260 aa AA seqDB search
MFEKFLSGKTAVVTGSNSGIGLGIAHELARAGADLVLNSFTDMPEDHALAESLAAEHGVE
VRYVQADMSKGADCRALIEKAGACDILVNNAGIQHVAPIPDFPGEKWDAIIAINLSSAFH
TTAAALPLMRKAGWGRVINIASAHGLTASEYKSAYVAAKHGIVGLTKVTALETAKEPITC
NAICPGYVLTPIVEKQIPDQMKTHNMSREDVIAKVMLQRQPSGQFATVEQMGGTAVFLCS
PAAEQITGTTISVDGGWTAL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagaaattcctcagcggcaagacggcggtggtgacgggctccaattcggggatc
gggctcgggatcgcgcatgaactggcgcgcgcgggcgctgatctcgtgctgaacagcttt
accgacatgcccgaggaccacgcccttgccgaaagccttgccgccgagcatggcgtcgag
gtgcgctatgtccaggccgacatgtccaagggcgccgactgccgcgccctgatcgaaaag
gccggcgcctgcgacatcctggtgaacaatgccggcatccagcatgtcgcaccgatcccg
gatttcccgggcgagaaatgggatgcgatcatcgccatcaacctgagttccgcctttcac
accacggcggcggcgctgcccctgatgcgcaaggcaggctgggggcgggtgatcaacatc
gcctcggcgcacgggctgacggccagcgaatacaaatcggcctatgtcgcggccaagcac
ggcatcgtcggcctgaccaaggtgacggcgctggagaccgcgaaggagccgatcacctgc
aacgccatctgccccggctatgtgctgaccccgatcgtggaaaagcagatccccgaccag
atgaagacccacaacatgagccgcgaggacgtgatcgccaaggtcatgctgcagcgccag
ccctcggggcaattcgccacggtcgagcagatgggcggcacggcggtcttcctgtgctcg
ccggcggcggagcagatcaccggcacgaccatctcggtggacggggggtggacggcgctt
tag

DBGET integrated database retrieval system