KEGG   Paracoccus denitrificans: Pden_1118Help
Entry
Pden_1118         CDS       T00440                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
pde  Paracoccus denitrificans
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Pden_1118
Enzymes [BR:pde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Pden_1118
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Pden_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1095264..1096037
Genome map
AA seq 257 aa AA seqDB search
MNSVTLTAVPGVPDIQPGDDLAAILGDALDRAGLWPADGDILCVAQKIVSKAEGCLIAYD
GVTPSDQAVELARELGKDPRKVQVVLDETRRIVRKFRSPGAREGTIICEHRLGFVSANAA
VDESNIGAEGAALILPRDPDASCRALALRLAQRFGASVGVVMTDTFGRPWRMGQVNVAIG
LAGVPATIREQGNTDAWGRVLQVTEPALADEIAAASGLVVRKNARTPLVLLRGLDWTPAA
DSRATDIIRKQQEDMFR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcgtcaccctgaccgccgtgcccggagtgcccgacatccagcccggcgacgat
ctggccgcgatcctcggcgatgccctggaccgcgccggcctgtggccggccgacggcgat
attctttgcgtggcgcagaagatcgtctccaaggccgagggctgcctgatcgcctatgac
ggcgtgacgccctcggatcaagcggtcgagctggcgcgcgaactgggcaaggacccgcgc
aaggtgcaggtggtgctggacgagacgcgccgcatcgtgcgcaagttccgcagccccggc
gcgcgcgagggcacgatcatctgcgagcatcggttgggctttgtctcggccaatgcggcg
gtggacgagtcgaacatcggggccgagggtgccgcgctgatcctgccccgcgaccccgat
gcaagttgccgcgcactggccctgcggctggcgcagcgctttggcgcctcggtcggggtt
gtgatgaccgatacgttcgggcggccctggcgaatgggtcaggtcaatgtcgccatcggc
ctggcgggcgtgcccgccaccatccgcgaacagggcaataccgatgcctggggccgtgtg
ctgcaggtcaccgagccggccctggccgacgagatcgcggcggcctcggggctggtggtg
cgcaagaacgcccgcacgccgctggtcctgttgcgcgggctggactggacacccgccgcc
gacagccgcgccaccgacatcatccgtaaacagcaggaggacatgttcagatga

DBGET integrated database retrieval system