KEGG   Paracoccus denitrificans: Pden_1151Help
Entry
Pden_1151         CDS       T00440                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pde  Paracoccus denitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pden_1151
Enzymes [BR:pde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Pden_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1126673..1127662
Genome map
AA seq 329 aa AA seqDB search
MTRKLTSAPKHGHTSMLYSTVHTDLDTLDADIAFLGIPYGSAYTMDEVTNDQTRAPTAVR
QATDRAVRLLDRYDFDIGGTLYDGRDVRAVDCGDVTGDPVDPKAHSRNAEEAVRKILAAG
ALPLIIGGDHGIPIPVLRAYDDQGPITLIQIDAHLDWRDQINGVHDGLSSPIRRASEMPH
VQEIFQIGIRAQGTARPEEYEAAQAYGSNIVTAYELHEKGMQAILERIPDGGRYYITVDA
DGVDPSVMPGVAGPAFGGVTYCQMRELLHGLVRKGRVVGMDIVEITPSKDVNQLTAIAAG
RFFVNLVGAAVRAGYFDQRISQRAARPAA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaagctgacctcggcgccgaaacatggccataccagcatgctctattcgacc
gtgcataccgacctggacacgctggatgccgatatcgcctttctgggcattccctatggc
tcggcctataccatggacgaggtgacgaacgaccagacccgcgcgccgaccgcggtgcgg
caggcgacggaccgggcggtgcggctgctcgaccgctacgacttcgacatcggcggcacg
ctctacgacgggcgcgacgtgcgcgcggtggattgcggcgacgtgaccggcgatccggtc
gaccccaaggcgcattcgcgcaatgccgaagaggcggtgcgcaagatcctggccgccggg
gcgctgccgctgatcatcggcggcgaccatggcatcccgatcccggtgctgcgcgcctat
gacgaccaggggccgatcacgctgatccagatcgacgcgcatctggactggcgcgaccag
atcaacggcgtgcatgacgggctgtcgagcccgatccgccgcgcctcggagatgccgcat
gtgcaggagatcttccagatcggcatccgcgcccagggcaccgcccgccccgaggaatac
gaggccgcgcaggcttacggctcgaacatcgtcacggcctacgagctgcacgaaaagggc
atgcaggcgatcctggagcgcatcccggacggtgggcgctattacatcaccgtcgatgcg
gatggcgtcgatccctcggtgatgccgggcgtggccgggccggccttcggcggcgtgacc
tattgccagatgcgcgagttgctgcacgggctggtgcgcaagggcagggtggtcggcatg
gacatcgtcgaaatcaccccgtcgaaggacgtgaaccagctgaccgccatcgctgccggg
cggttcttcgtgaacctggtcggcgccgccgtccgcgccggctatttcgatcagcggatc
agccagcgcgccgcccggcccgccgcctga

DBGET integrated database retrieval system