KEGG   Paracoccus denitrificans: Pden_1186Help
Entry
Pden_1186         CDS       T00440                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pde  Paracoccus denitrificans
Pathway
pde00625  Chloroalkane and chloroalkene degradation
pde00680  Methane metabolism
pde01100  Metabolic pathways
pde01120  Microbial metabolism in diverse environments
pde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Pden_1186
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pden_1186
Enzymes [BR:pde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Pden_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ABL69291
JGI: Pden1186
UniProt: A1B197
Position
1:complement(1157466..1158650)
Genome map
AA seq 394 aa AA seqDB search
MSSNRGVVYIGPGKVEVQDIADPKLEAPDRRKIAHGVILKVVSTNICGSDQHMVRGRTTA
EPGLILGHEITGEVIEKGADVEMLEIGDIVSVPFNVACGRCRCCREGDTGVCLTVNPSRA
GGAYGYVDMGGWIGGQARYVMVPYADFNLLKFPDRDRAMAKIRDLTMLSDILPTGFHGAW
KAGVGVGSVVYVAGAGPVGLAAAASARILGAAVVMVGDFNKERLEHARKVGFEPVDLSKG
DDLPEMIAQITGTPEVDAAIDAVGFEARGHSGGEQPAIVLNQMMQITRAAGQIGIPGLYV
TEDPGAVDDAARHGSLSMRFGLGWAKAQSFHTGQTPVLKYNRQLMQAILHDRLPIADIVN
ATVIPLDQAVQGYESFDRGVAKKFVLDPHGMLAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacagaggcgtggtctatatcggccccggcaaggtcgaggtgcaggacatc
gccgacccgaagctcgaggcgccggacaggcgcaagatcgcgcatggcgtgatcctgaag
gtcgtctcgaccaatatctgcggctcggaccagcacatggtccgcggccgcaccaccgcc
gagcccggcctgattctgggccatgagatcaccggcgaggtgatcgagaagggtgccgat
gtcgagatgctggagatcggcgacatcgtttccgtgcccttcaacgtcgcctgcggccgc
tgccgctgctgccgcgagggcgataccggggtctgcctgacggtgaacccgtcccgcgcc
ggcggtgcctatggctatgtcgacatgggcggctggatcggcgggcaggcgcgctatgtc
atggtgccctatgccgatttcaacctgctgaaattccccgaccgcgaccgggccatggcg
aagatccgcgacctgaccatgctgtccgacatcctgcccaccggctttcacggcgcctgg
aaggcgggcgtgggcgtcggctcggtggtctatgtcgcgggcgccggtccggtgggcctc
gcggcggccgcctcggcccgtatcctcggcgcggcggtggtcatggtcggcgatttcaac
aaggagcggctggaacacgcccgcaaggtcggcttcgagccggtggacttgtcgaaaggc
gacgacctgcccgagatgatcgcccagatcaccggcacgcccgaggtcgatgccgccatc
gacgcggtgggtttcgaggcacgcggccattccggcggcgagcagccggccatcgtgctg
aaccagatgatgcagatcacccgcgccgccggccagatcggcattcccgggctttacgtg
accgaggatccgggcgcggtcgacgacgcagccaggcatggcagcctgtcgatgcgcttc
ggcctgggctgggccaaggcgcagagcttccacaccggccagaccccggtgctgaaatac
aaccgccagctgatgcaggcgatcctgcacgaccgcctgccgatcgccgatatcgtgaac
gccacggtcatcccgctggatcaggcggtgcagggctatgaaagcttcgaccggggcgtg
gcgaagaaattcgtcctcgacccacatggcatgctggcggcctga

DBGET integrated database retrieval system